Cherry SNP DataBase

Gene information

Gene Pav_sc0000311.1_g940.1.mk
Chromosome name PAV_r1.0chr7
start 18660681
end 18665670
PAV_r1.0 name Pav_sc0000311.1
start 441292
end 446281
direction -
Annotation NR PREDICTED: calmodulin-binding receptor-like cytoplasmic kinase 3
Sequence CDS ATGTTTCATCATCTTTTCATTCAGAAAATGGAAATTGAGCACATTATCCCGTTAAGAACG GCCATCACTATGTTGAGTCTGTTGCTTCTGGTGAAATTGCCAGCAATCTCTTCCTCTGAG TTTGTTATACAGTCAAAGGTTTGCAGTGATCACATTGCCTATTCAAAATCTTATGGTCTT GAACTGTATTACATAAATGGGAATTCAGTAGAGAAAGCTTTATTCTGTACGGCACTTGAG ACATACTACGCAAATGGTTGCATTTTGGAGGGCTACCTTGGCATTAACCATTGTGTATCA GACCTTTCACTAGTTGGTTTTCACTTGAGGACAGGAAGGAAACTTTTGCAAAAGGAGTCA ATGGATAAATCCACGTCCCACGATGGAGAAGAAAAGAACGGCTTTGCATCTGTATCCATG ACCAAAAAAGTTGGAATGGCAGCAGGTGCAATGTCTTTGTTATGTTGTGTTTTCATGTGT CCCTGCTTTTATAAGAAAAGGAGAGAAGCTGCTCACAAAGTTCTTGCTAAGGACCCAAAT TCAATGGATTCAGCCTCTTCTTCTTTTGAAGTGAATTCTGCTCCTGAAAAGATCCCGGCT AGTCCGCTTCGTGTGCCACCTAGTCCTAGATTTTCAATTTCTCCAAAACTCAGTAGACTT GGATCGGTACATCTCAGTTTGAGTCAGATTGCCAAAGCAACCCGCAACTTCTCTCAATCA CAACAAGTAGGTGAAGGAGGTTTTGGAACTGTCTACAAAGCCCGGCTAGACGATGGCCAA GTGGTTTCTATAAAACGAGCTAAGAAGATCCCGGCTAGTCCGCTTCGTGTGCCACCTAGT CCTAGATTTTCAATTTCTCCAAAACTCAGTAGACTTGGATCGGTACATCTCAGTTTGAGT CAGATTGCCAAAGCAACCCGCAACTTCTCTCAATCACAACAAGTAGGTGAAGGAGGTTTT GGAACTGTCTACAAAGCCCGGCTAGACGATGGCCAAGTGGTTTCTATAAAACGAGCTAAG AAGGCCTTCAAGAAGCTGAATGAAGGAAGGATGGTGGAATTGGTTGATCCTGCATTGCAG GAAGTTGTAGATGCAGAGGTAGTGGTGAAAATTTTTGATTTGGCTATCCAGTGTGCTGCC CCCATTCGAGCTGATCGGCCAGACATGAAATCAGTGGGAGAGCAGTTGTGGACAATAAGA GCAGACTATCTTAGAAGTGTCAAGAAAGGCTAG
PEP MFHHLFIQKMEIEHIIPLRTAITMLSLLLLVKLPAISSSEFVIQSKVCSDHIAYSKSYGL ELYYINGNSVEKALFCTALETYYANGCILEGYLGINHCVSDLSLVGFHLRTGRKLLQKES MDKSTSHDGEEKNGFASVSMTKKVGMAAGAMSLLCCVFMCPCFYKKRREAAHKVLAKDPN SMDSASSSFEVNSAPEKIPASPLRVPPSPRFSISPKLSRLGSVHLSLSQIAKATRNFSQS QQVGEGGFGTVYKARLDDGQVVSIKRAKKIPASPLRVPPSPRFSISPKLSRLGSVHLSLS QIAKATRNFSQSQQVGEGGFGTVYKARLDDGQVVSIKRAKKAFKKLNEGRMVELVDPALQ EVVDAEVVVKIFDLAIQCAAPIRADRPDMKSVGEQLWTIRADYLRSVKKG


| Top |