Cherry SNP DataBase

Gene information

Gene Pav_sc0000323.1_g310.1.mk
Chromosome name PAV_r1.0chr6
start 5755475
end 5759074
PAV_r1.0 name Pav_sc0000323.1
start 161265
end 164864
direction -
Annotation NR PREDICTED: uncharacterized protein YKR070W
Sequence CDS ATGAGCCTCCGAATACTGAGAAAGGCTTCGCAGACGCAAAACGCAAAGCAATTATCCTCC ATTTTCTCCAAATTCACACGATCATTCTCGCAGCTCTCCTCACAGTCCAAACCGCCTTCC TTTGGCATTGCGTTCGACATCGACGGCGTCGTTTTACGCAGCGAAGCTCCCATCGGAGGC TCTCCTCAGGTCTTAAGAAGATTGTACGACGATTCTGGTAATCTTAGCATTCCGTACGTG TTCTTGACAAATGGTGGTGGGTTTACTGAATCTAAAAGAGCCCTTGAGTTAAGTGAACTT TTGGGTGTCAAGATTTCACCTTTACAGGTTTTACAGGGCCATACACCTTTTAAGCAGTTA GTAAACAGATTTGAGAATGAACTCATTGTTGCTGTGGGGAAAGGAGAACCTGCTGCAGTT ATGTCTGAATATGGATTTAAAAATGTTCTTTCAATTGATGACTATGCGTCCTGCTTTGAA AACATTGACCCACTAGCACCGTATAAGAAATGGACAACTAAGCAGGTTAAGGAGGTTGCT GCCAGAGACCTTGTATCCTCACAAAGAGTTCAGGCGGCGTTTATAGTTAGTGATTCTGTT GATTGGAGCAGAGACATTCAGGTTCTATGCGACATTTTTAGAACTGGTGGTCTTCCTGGT CGGGAAATTGGACACCAACCACATCTTTATTTTGCGCATGATGACCTTGCATACCAGGTT GATTCTCCTTCCCCTGCTGCTTTTCCTACTGAGCGTTTTGGAATGGGAGCTTTCAGAATT GCACTAGAATCCATCTTTAATAGAATCCATCCTCATGCTCTGGAGTACACAACTTTTGGG AAACCAAATCCATTTGTATTCAAGAATGCAGAACTTGTACTTAAGCAACTTGTGTCAGCT CTTCATAATAATCTTCAAGTTGCCACCAATCAAGCAAATGCTGGAAGTTACCAATTCAAA ACACTGTATATGATAGGAGATAATCCTTCGGTTGACATCAATGGTGCACGACAGGCGGGT CATCCCTGGTTTTCTATTCTGACAAGGACTGGGGTTTTCAAGGGAAAGGAAAATCATGCC GAATTTCCAGCGGATCTGGTTGTTGACACTGTGGAAGAAGCTGTAGACTTTGTTTTGAGA AAGGAATACATCTCTTAG
PEP MSLRILRKASQTQNAKQLSSIFSKFTRSFSQLSSQSKPPSFGIAFDIDGVVLRSEAPIGG SPQVLRRLYDDSGNLSIPYVFLTNGGGFTESKRALELSELLGVKISPLQVLQGHTPFKQL VNRFENELIVAVGKGEPAAVMSEYGFKNVLSIDDYASCFENIDPLAPYKKWTTKQVKEVA ARDLVSSQRVQAAFIVSDSVDWSRDIQVLCDIFRTGGLPGREIGHQPHLYFAHDDLAYQV DSPSPAAFPTERFGMGAFRIALESIFNRIHPHALEYTTFGKPNPFVFKNAELVLKQLVSA LHNNLQVATNQANAGSYQFKTLYMIGDNPSVDINGARQAGHPWFSILTRTGVFKGKENHA EFPADLVVDTVEEAVDFVLRKEYIS


| Top |