Cherry SNP DataBase

Gene information

Gene Pav_sc0000351.1_g470.1.mk
Chromosome name PAV_r1.0chr1
start 18851293
end 18859166
PAV_r1.0 name Pav_sc0000351.1
start 262102
end 269975
direction -
Annotation NR PREDICTED: DNA polymerase alpha subunit B
Sequence CDS ATGGTTCAAGCCAATGATGTCGAAGATGCCACAGCCAGGCAGAAGCAGATTGATGATTGG CTTCCCATCACTTCTGCTAGGAATGCCAAATGGTGGTACTCTGCTTTCCACAATGTCACT GCCATGGTTGGGGCTGGCGTCCTCAGCCTTCCTTATGCCATGTCAGAACTTGGATGTTAC TCAACAATTGCATGGGGAGCTGCTTTACACAAGGGGGTTGAACCAAACGTGGACTACAGC TACAAAGCTAAAACCAATTCTGGAGCTGTCTTTAACTTCTTCAGCGGGTTGGGAGACATA GCATTTGCCTACGCCGGTCACAATGTGGTTTTGGAGATCCAAGCAACCATTCCCTCTACG CCGGAGAAGCCTTCCAAGGGTCCCATGTGGAAAGGAGTGATTGTGGCATACATTGTGGTT GCTTTGTGCTACTTCCCTGTTTCTTTTGTTGGCTACTGGGTTTACGGAAACAAAGTCGAA GACAACATCCTCATCTCATTAGAGAAACCCGTTTGGCTAATTGCAGCTGCTAACATGTTT GTTGTGGTCCATGTCATTGGAAGCTACCAAGTGTTTGCAATGGGAGTGTTTGACATGGTT GAAACTTTTCTGGTCAAGAAGATGAACTTCACGCCTTCTTTCGCCCTTCGATTTGTTACT CGCACTACATACGTCGCTTCCCTGCATCATGTGGCTTTCCCTCTACAAACCAAGACGATT CAGTCTATCTTGGTGCATGAACTGGGCGCCACATTCTGCATAAATTTCAGACTCACGCCC GCGGATCTCGTTTCAAGCTGGGAGATTTACTACCTCAACAGGATTTTGAATGATGAAGAT GAAGATATAAAGGAAGACGTTCTTGGCACTCCACCACCATTCAAATCTCAGAACCACTAC TCAGAGCCATCTGACTCAACGCCGCAAACAATTGGGAACATTTCTTCTGGGAAACCATCG AAACTTGCAACTCCTTTTGGGCGACGAACAGACAAGTTGGTTGTGAAGTTTAGCATCAAT AATAAGCCAAATACAGAGAACGGGGAAAAGGAAGATGATAATGAGAATCATGAGGATGAT GACATTATCAGGAAGGTTAAGCCTGGAAAGAGGTGTTCTTTAATAGTCCATGGTTCAGGT CCTGAAATAGGCTGTAGGTTTATGCATGATAGGATTGAAGATAGGTTTAATGCACTTGAA AACCGAATTAGTAAGTATGCAACTGCACTGGTTTCATCTGGGCAGTATGAGGAACCGCTG GATCCTACAGTTTCTTCTCAGAAAATCATATTTACTGTTGGCATGATCTATTGTGATGGA GAGGGCCATTTGAATGAGAAGTCCACCTTGTTGCAAAGCAGCGCAGAACATTCTGGAGGC CAGCGTGTTCGTATAGAATTACAAAACTTGAGCCAGTTTTCAATCTTTCCAGGCCAGCTA GTAGGTATCGAAGGGATCAATCCTAGTGGACACTGCTTTATTGCTTCAAAACTGGTAGAT TCAATCCCTTTGCCTATTGCTGATGATGCAAACTTGCCTCCTGCAAAAAAGCAAGCTTTG GATCAGGAGATTTTGCCAGTTGGTGTATCCAGTACACAAACAGAGCTATCAGTGATCATC GCATCAGGCCCTTTTACCACAACAGACAACTTATTGTTTGAGCCTCTAAGAGAGCTGCTA GCATATGCAAGCAAAACGCTGCCTCAGTTGCTTATATTGCTAGGACCATTTATTGATTCC GAACATCCAGAAATTAAGAAAGGAACTGTGGACAGGAGCTTTGATGAAATTTTCCGTGCC GAGATTCTTAGAAGGTTGCAAGACCATGTCGAATACATGGGTTCACATGCACGCGTTGTT CTTGTACCATCTATACGGGATGCTAACCATGACTTTGTTTTCCCTCAGCCTGCTTTTGAT ATTCATCCTGCTAATCTCAGGCATCAGATAACCAGTCTCACAAATCCAGGGCTTTTCGAG GCAAATCAGGTCAAGATAGGTTGCTGCTCTGTGGATATTCTCAAACACCTTAGTGGAGAG GAGATCTCGCGTAATCCAAAGGATGGAAAACTCAGTGATCGCATGACAGAAGGCATTCCA TTGGATTTTTCGCTTGCTCCTGAAGCTCTAAACATCTCGTTGATCCCAGATATTCTCATC TTACCCTCTGACATGAAGCATTTTGTGAAGGTACTGTCCCTTGGTGAAAGAGGTGAAGAG AAAGAGCAGGTTAAATGCATTTGTGTCAATCCGGGAAGACTGGCCAAGGGAGAAGGAGGA GGTACTTTCGTCGAGCTTAACTACTATGGTAATCCTGACACAAGCAATGCTTCGATCATA GGCATATAA
PEP MVQANDVEDATARQKQIDDWLPITSARNAKWWYSAFHNVTAMVGAGVLSLPYAMSELGCY STIAWGAALHKGVEPNVDYSYKAKTNSGAVFNFFSGLGDIAFAYAGHNVVLEIQATIPST PEKPSKGPMWKGVIVAYIVVALCYFPVSFVGYWVYGNKVEDNILISLEKPVWLIAAANMF VVVHVIGSYQVFAMGVFDMVETFLVKKMNFTPSFALRFVTRTTYVASLHHVAFPLQTKTI QSILVHELGATFCINFRLTPADLVSSWEIYYLNRILNDEDEDIKEDVLGTPPPFKSQNHY SEPSDSTPQTIGNISSGKPSKLATPFGRRTDKLVVKFSINNKPNTENGEKEDDNENHEDD DIIRKVKPGKRCSLIVHGSGPEIGCRFMHDRIEDRFNALENRISKYATALVSSGQYEEPL DPTVSSQKIIFTVGMIYCDGEGHLNEKSTLLQSSAEHSGGQRVRIELQNLSQFSIFPGQL VGIEGINPSGHCFIASKLVDSIPLPIADDANLPPAKKQALDQEILPVGVSSTQTELSVII ASGPFTTTDNLLFEPLRELLAYASKTLPQLLILLGPFIDSEHPEIKKGTVDRSFDEIFRA EILRRLQDHVEYMGSHARVVLVPSIRDANHDFVFPQPAFDIHPANLRHQITSLTNPGLFE ANQVKIGCCSVDILKHLSGEEISRNPKDGKLSDRMTEGIPLDFSLAPEALNISLIPDILI LPSDMKHFVKVLSLGERGEEKEQVKCICVNPGRLAKGEGGGTFVELNYYGNPDTSNASII GI


| Top |