Cherry SNP DataBase

Gene information

Gene Pav_sc0000354.1_g280.1.mk
Chromosome name PAV_r1.0chr1
start 20488527
end 20492677
PAV_r1.0 name Pav_sc0000354.1
start 170917
end 175067
direction -
Annotation NR PREDICTED: spermidine synthase
Sequence CDS ATGGCGGAAGAGATTGTGGCGGGGTCTGCTGATTTTCCATTGAAGAGGTCCAGAGAGGAA GAAGAGAACGGAGTCTATGCGGCCTCAACCGTGTCTGTGGAGACTGACACTGGCAAAGAG GCTGATGGTGTTTCTGCTGTTATTCCTGGGTGGTTTTCAGAGATTAGCCCAATGTGGCCA GGAGAGGCACATTCCTTGAAGATAGAGAAGATTCTATTTCAAGGGAAGTCTGACTATCAG GATGTGATGGTCTTCCAGTCATCAACATATGGAAAGGTTCTTGTATTGGATGGGGTGATT CAGCTAACCGAAAGGGATGAATGTGCCTATCAAGAAATGATTACTCATCTTCCCCTCAGC TCAATTCCAAACCCAACGAAGGTTTTGGTTATCGGTGGAGGAGATGGTGGAGTCCTGCGG GAAGTGGCTCGCTATTCTTCTGTTGAGCAGATAGATATATGTGAGATTGACAAGATGGTG GTTGATGTGTCTAAGCAGTTTTTCCCTGCTGTAGCTATTGGATATGAGGACCCACGAGTC ACACTTCATGTTGGTGATGGAGTTGCATTTTTGAAGGCTGTTCCTGCAGGAACTTATGAT GCTGTAATAGTGGACTCGTCTGACCCAATAGGTCCTGCACAAGAGCTTTTTGAGAAGCCC TTTTTTCAGACGGTAGCAAATGCTCTTCGTCCAGGAGGAGTCGTGTGTACACAGGCAGAG AGTATATGGCTTCACATGCACATCATTGAGGATATTGTGGCCAACTGTCGCCAGATATTT AAAGGCTCCGTCAACTACGCATGGACTACAGTCCCTACATATCCAAGGCATGCACTTTTC TCAGTCTCTTTTACATCCTCTCCCTCTGTCTCTCTCTCCCTCATACACACGCACACACAG GTCCACAAGGATGTGTCTGCATGTGGGGTGATTGGTTTTATGCTTTGTTCTACCGAGGGA CCTGCTGTGGATTTTAAGCACCCTGTGAATCCAATTGATGCAAGTGACAGTCAAAAATCA AGACCATTGAAATTTTACAACTCTGAGATTCACACAGCTGCTTTCTGTCTACCATCTTTT GCAAAGAAGGTGATTGATGCAAAAGCAAATTGA
PEP MAEEIVAGSADFPLKRSREEEENGVYAASTVSVETDTGKEADGVSAVIPGWFSEISPMWP GEAHSLKIEKILFQGKSDYQDVMVFQSSTYGKVLVLDGVIQLTERDECAYQEMITHLPLS SIPNPTKVLVIGGGDGGVLREVARYSSVEQIDICEIDKMVVDVSKQFFPAVAIGYEDPRV TLHVGDGVAFLKAVPAGTYDAVIVDSSDPIGPAQELFEKPFFQTVANALRPGGVVCTQAE SIWLHMHIIEDIVANCRQIFKGSVNYAWTTVPTYPRHALFSVSFTSSPSVSLSLIHTHTQ VHKDVSACGVIGFMLCSTEGPAVDFKHPVNPIDASDSQKSRPLKFYNSEIHTAAFCLPSF AKKVIDAKAN


| Top |