Cherry SNP DataBase

Gene information

Gene Pav_sc0000354.1_g410.1.mk
Chromosome name PAV_r1.0chr1
start 20396200
end 20409485
PAV_r1.0 name Pav_sc0000354.1
start 254109
end 267394
direction -
Annotation NR PREDICTED: pre-mRNA-processing factor 17 isoform X2
Sequence CDS ATGGATCTTCTCCGAGCCTACTCTGATCAAAACGACGAAGAATTGAACGAGCCAGAGCAG CAAAACCAAAACCCTAGTTCAACAACATCGTCCCCAGACGCTTCACCTCCTCGGCTCCTC CCCGCCAAGTCCGCCGCGCCCAATGTCGACGACACGATGCTGGCCCTGACGGTGGCTGAT GGCCATCGGTCTTTGAGTCGGCCAATTGACCCGACCCAACATATCGTCGGCTTCAACCCC ACCTACGACCAACTATGGGCCCCAATCTACGGCCCATCTCATCCCTACGCCAAGGACGGC ATCGCCCAGGGCATGCGCAACCACAAGCTCGGCTTCGTTGAGGACGCCTCTATTGAACCC TTCGTCTTCGATGAGCAGTACAATACTTTTCACAAGTATGGCTACGCGGCCGACCCATCA GCCTCTGCTGGGTATAATTACGTTGGTGATTTTGAGGCCTTGCAGAAGAATGATGCCGTT TCGGTATATAACATACCCCAGCACGAGCAGAAGAAGCGGAAGATAGAAAAGAGGAAGGAA TTAGAGGAAGATGAGGGTGTGGATGACGATATGGACCCAGAGGAGGTCCAAAACCCGGCC AGTGATGTGTGGTTGATGAAGAATAAGAAGAGCCCATGGGCGGGCAAGAAGGACGGTCCG CCAACGGAGCTCACAGAGGAGCAGAAGAAGTATGCCGAGGAGTATGCGAAGAAGAAAGGT GAAGAGAGAGGTGGTGGTGATAAGGGTGAGGTTGTGGTTGAAAAAACTACATTTCATGGG AAAGAAGAGAGGGATTATCAGGGTAGGTCTTGGATTGCGCCCCCTAGAGATGCTAAGGCA TCTAATGATCACTGTTATATTCCAAAGAGGTTGGTGCACACTTGGAGTGGACACACAAAG GGTGTATCTGCTATTAGATTCTTCCCTAATTACGGGCATTTGATTCTCTCTGCTGGGATG GATACCAAGGTGAAAATTTGGGATGTTTTCAATACTGGTAAGTGTATGAGGACTTACATG GGTCATTCTAAGGCAGTTCGGGATATATGTTTCAATAATGATGGGAGTAAATTTCTGACT GCTAGTTATGATAAGAATATTAAGTACTGGGATACAGAAACCGGGCAAGTGATATCTACA TTCTCGACCGGGAAGGTTCCATATGTGGTTAAGCTTAACCCGGATGAGGATAAGCAGAAT GTGTTGTTAGCTGGGATGAGTGATAAGAAGATTGTTCAGTGGGATATGAACGAGGGAAAG ATCAATCAAGAGTATGATCAACATTTGGGTGCTGTGAATACGATTACATTTGTTGATAAT AACCGGAGGTTTGTTACTTCCAGTGATGACAAATCGCTTCGAGTATGGGAGTTTGGGATC CCTGTGGTTATTAAGTATATTAGTGAGCCTCACATGCATTCTATGCCATCAATTTCACTG CACCCCAATTCAAATTGGCTTGCAGCACAAAGTATGGACAATCAGATTCTGATTTATAGC ACTAGAGAGAAGTTTCAGCTGAATAAGAAGAAAAGGTTTGCTGGGCATGTCGTTGCTGGT TCGTGGAGAACTGTTGCAGTTGCTTACACAAACACACAATATGTTTTGCATTCTCCTTTT GATATTGAATTTGGGACTAGCTACATTTTAGTTCGGTTTGGACAAGGGTACTATAATTTG ATGCACCCTTTTCTGCTCAGTACGGTGACTAGTCCTCGAAACGATGTCGTTTTTAACCTA GTTAGCGACCTTAAGCCTCTTCCATCCCTGGACCTTACTGGTCACCACTGTCGTGTCGCG AGATATGGGTCGTATGTGGATGAGACGGATCCTACTCAGACAAAACTCTCTACCTCTGCT GAAGCCTCCCATGGCCTGCTTGTTAACGCCTGCGACACCCCAAAAGCCCATCTCCTCTCC CTTTCTGAAACCATCACCACCAACTTTCGCTCCTCTTGCCTCGTCCCACCGTCGCTCTCT TTCAACAGCAACAGCTTTTTCTCTTCCGGATCCTCTCGAGGAGATGACGGCGTTGGAACT TCAAACAAGGGCTTGAAGGTTCTTCTCAAGGGCATGACATACGATGAGCTTGAAAAATGG GTTCAGTCTCATGGCTACAGGCCTGGCCAGGCTTTAATGATATGGAAACGTCTCTATGGG AACGGTATCTGGGCGCATCATAGTGATCAGCTGGAAGGCTTGAATAAAGATTTTAAGAAG ATGTTGAGTGAGAATGCTGAATTCAAGGCATTGTCTTTGAAACAAGTTATTACTGCCGCT GATGGAACTAGGAAGGTCGTTCCTTGTATTTCTTTGAGAACCTTCTCATTGATTATGAAA CTCACAGGAGGTTTCAGATTTTGTTCACTTTGGAAGATGGATTGGATGGGTTTAAGAAGA CATCTGACTGCTGCTGAGATTGTGGAGCAGGCTGTCTTTGCACGGTGCCTGCTTACAAGT GAAGTTGGTGACATTACAAATGTTGTATTTATGGGAATGGGAGAACCACTTCAGAACATT GACAATGTTCTTAAAGCTACAGACATAATGCTACACGATCAAGGCCTTCATTTCAGTCCT CGCAAGATCACTGTTTCAACAAGTGGGCTTGTCCCCCAGCTGAGGCGTTTCCTCAAAGAA TCTAATTGTGCTTTAGCTGTTAGTTTGAATGCAACGACTGATGAGGTCAGAAACTGGATC ATGCCAATTAACCGGAAATATAACATAGGCTTGCTTCTTCAGACCCTTAGGGAGGAACTT CGCTTCAAGAATAACTACAAAGTTCTTTTTGAATATGTAATGCTTGCAGGAATTAATGAT AGCATTGAGGATGCAAGGAGGCTTGCTGATCTCGTTCAGGGAATTCCATGCAAGATCAAT CTTCTCTCATTTAATCCTCATGGCGGATCCCAATTCAGACCAACCAGTGACGAGAAGATG ATTGAATTTCGCAATCTTTTGGCAGAAGCAGGGTGTGTTGTCTTCATGCGGTCGAGTAGA GGTGATGATCAGATGGCTGCTTGTGGTCAGCTTGGAAATCCTGGTGCAATCCAGGCTCCC TTGCTCCGTGTGCCAGAGCAATTCAAAATGGCAATGGAAGTCCTTGGAGCTGTCTCCTGT GGTGCATTGGCGTCGCATCGAACAAACTTGGGGTATCTGGCCTTTTTGGGATTCCTATCT TCCCTCCCGCCTCGTATCACCATGGCGTGCATGTTCAATCTTAGCTTTCTCTTGCTTCGT GATCTTAAGCAACTTGGTCTGACACACATGGTTTACCCTGGGGCTGCACATTCTCGATTT GAGCATTCACTGGGAGTGTATTGGCTGGCTGGTGAAGCTGGCCAGGAGCTTGGAATTGAG GAGTTTGACAGGAACACAGTAAAACTTGCTGGACTACTGCATGATATTGGCCATGGCCCT TTCAGCCACATGTTTGAGCGCGAGTTTCTTCCTCGGGTTCTTGATGGTTACGAATGGTCT CATGAGGATATGTCTGTGAAGATGATAGACTACATTGTCGACAAGCACTGTATTGATATT GATTCTGCAATCCTCAAGACTGCGAAGGAAATGATCCTTGCCAGCTCTGAACATGGGCCA CAAAAAAGCATGACAGAAAAGCGTTTCTTGTATGATATTGTTGCAAATGGGCGAACTGAA ATAGATGTTGACAAGTTTGATTACATTGTGCGTGACTCCCGAGCATGCGGTATTGGTTCT GGTTTTCAATTTGAAAGGCTGATGGAAACAATGAGAGTGATGGAGGATGAGATATGTTAT CGCGCTAATGACTATCTGACACTCCACAAGCTATTTGCCACTCGTGCTGATCTTCATCGG ACTGTGTACACACATCCAAAAGTGAAGGCTATTGAACTCATGGTTGTTGATGCTCTGTGC TATGCAAATGCTGATCTTGGCATTGCAGCTTCAGTTCAAAAACCATCTGAATTTTGGAAG TTGGATGACTCAATTTTGAAATGGATCGAAACCTCTGATTCTGATAGCCCTAGCCTCAAG GAAGCTAGGAATTTAATCCAACGCATCCGTAAAAGGGATCTGTACCAGTACTGCAATCAG TTTTCTGTTCCAAAGGACAAGCTAGAGAATTTCAAAGACATCACACCCCAAGATATAATT TGTTCACAGAAATCTGGTGGTGTTACACTGAAGGAAGAAGATGTTGCTGTGAGCACTGTC AAAATTGATTTGACTCATGGAAGGATGAACCCTCTTGAACGACAGGTTGGTTTTTATCAG GATTATGATAGCTCTGAGAAATTTCGAATCCCAGATGATCGCATAAGTCACTTGCTTCCC AGATTTTTCCAAGATAGGATAGTGAGGGTGTACGCAAAGAAGCCGGAACTGGTGGAAGCA GTTGCTGAGGCCTTTGAGAACTATCAGGTGGAGACATATGGATGTAAAGCCCAGGTACAT GCAACTCCTGACAAAAAGAAGGCACGCAAACAACTGGAATAG
PEP MDLLRAYSDQNDEELNEPEQQNQNPSSTTSSPDASPPRLLPAKSAAPNVDDTMLALTVAD GHRSLSRPIDPTQHIVGFNPTYDQLWAPIYGPSHPYAKDGIAQGMRNHKLGFVEDASIEP FVFDEQYNTFHKYGYAADPSASAGYNYVGDFEALQKNDAVSVYNIPQHEQKKRKIEKRKE LEEDEGVDDDMDPEEVQNPASDVWLMKNKKSPWAGKKDGPPTELTEEQKKYAEEYAKKKG EERGGGDKGEVVVEKTTFHGKEERDYQGRSWIAPPRDAKASNDHCYIPKRLVHTWSGHTK GVSAIRFFPNYGHLILSAGMDTKVKIWDVFNTGKCMRTYMGHSKAVRDICFNNDGSKFLT ASYDKNIKYWDTETGQVISTFSTGKVPYVVKLNPDEDKQNVLLAGMSDKKIVQWDMNEGK INQEYDQHLGAVNTITFVDNNRRFVTSSDDKSLRVWEFGIPVVIKYISEPHMHSMPSISL HPNSNWLAAQSMDNQILIYSTREKFQLNKKKRFAGHVVAGSWRTVAVAYTNTQYVLHSPF DIEFGTSYILVRFGQGYYNLMHPFLLSTVTSPRNDVVFNLVSDLKPLPSLDLTGHHCRVA RYGSYVDETDPTQTKLSTSAEASHGLLVNACDTPKAHLLSLSETITTNFRSSCLVPPSLS FNSNSFFSSGSSRGDDGVGTSNKGLKVLLKGMTYDELEKWVQSHGYRPGQALMIWKRLYG NGIWAHHSDQLEGLNKDFKKMLSENAEFKALSLKQVITAADGTRKVVPCISLRTFSLIMK LTGGFRFCSLWKMDWMGLRRHLTAAEIVEQAVFARCLLTSEVGDITNVVFMGMGEPLQNI DNVLKATDIMLHDQGLHFSPRKITVSTSGLVPQLRRFLKESNCALAVSLNATTDEVRNWI MPINRKYNIGLLLQTLREELRFKNNYKVLFEYVMLAGINDSIEDARRLADLVQGIPCKIN LLSFNPHGGSQFRPTSDEKMIEFRNLLAEAGCVVFMRSSRGDDQMAACGQLGNPGAIQAP LLRVPEQFKMAMEVLGAVSCGALASHRTNLGYLAFLGFLSSLPPRITMACMFNLSFLLLR DLKQLGLTHMVYPGAAHSRFEHSLGVYWLAGEAGQELGIEEFDRNTVKLAGLLHDIGHGP FSHMFEREFLPRVLDGYEWSHEDMSVKMIDYIVDKHCIDIDSAILKTAKEMILASSEHGP QKSMTEKRFLYDIVANGRTEIDVDKFDYIVRDSRACGIGSGFQFERLMETMRVMEDEICY RANDYLTLHKLFATRADLHRTVYTHPKVKAIELMVVDALCYANADLGIAASVQKPSEFWK LDDSILKWIETSDSDSPSLKEARNLIQRIRKRDLYQYCNQFSVPKDKLENFKDITPQDII CSQKSGGVTLKEEDVAVSTVKIDLTHGRMNPLERQVGFYQDYDSSEKFRIPDDRISHLLP RFFQDRIVRVYAKKPELVEAVAEAFENYQVETYGCKAQVHATPDKKKARKQLE


| Top |