Cherry SNP DataBase

Gene information

Gene Pav_sc0000357.1_g070.1.mk
Chromosome name PAV_r1.0chr8
start 15580007
end 15584376
PAV_r1.0 name Pav_sc0000357.1
start 26995
end 31364
direction -
Annotation NR PREDICTED: probable L-type lectin-domain containing receptor kinase S.5
Sequence CDS ATGAAGATTGACAAGGAAATCTCTCACCCCATCCACCTACAACACAAGCTCAAGATTGAA TACACAGAGATCCCATTCTACTGTGATGGGTGCAAAGAACCTGGCATTGGCCTCAAATAC AAGTGTCAGAAATGTGAGTTTGACTTGCATAAGGCATGTGCTGTGGCTGCTCCCAACATC CACCATCCCTTCTACAACAAATGTGAGTTTCAGTTTCTTTACAACCCGCCAGGTGCTGCT AGGAGAGTGTGTGATGTATGTAGGAAGGATGTTTTGGGGTTTGTGTACCACTGCTGGAGA TGTGATTTTGATCTGCACCCTTGTTGTGCAAACCTCCCACAAGTCCTAGATGATGGGGAG CACAACCTTTACTTGTGCCTCAAGTTATCTGGTCCTTGTCATAGGTGTGGAGGCAAGGGG CCTGGTTGGTCTTACAGGTCTGATTGCAAGACCTATAACCTTCATGTGTCATGTGTGAAG GAGTTGCTTGTGGAGAGCTGGCAAGCCATGTATCTCAATGTGGACAAGAACAAAGTTAGG GAAATGCAGACTAGAATCCCAAGCCTTAAGGGAACACTGAAAAACCATCATGGAGGGAGA GGAGGAGGAGGAAAGGTCAGAAAGTGTTGCCAGATTGCTGGTGGTGCCGTTCGTGTTATT GTCTCTGCCATCCTGGGAGATCCTACTGCTCTTATAGGCGCGGTTGTCGGCGGTTTCATA TCCAAGAATATGGGGCTTCCGAAAGGAATATTAATCACCTTTCTAGTTGTCCCTTTTGCC ATAATGCTGCATCAAGCTGCCATAGGCACTGCAGAATCAGCAGCTAAGCCGAAAGATTTC CCTTTTCGTGTATTTGATGAAAAAACTGACCAAGCTGCCTTCCGCTTTGAAGGCGTTTCT TCCATTGATCAGGGGGCACTTCAGTTAACCCCAGACACTCTGAACCAAGCCTTTCTCTTA CCCAACAGGTCCGGGCGCATCATGTACTACAGAGCTTACAGACTATGGTTGTCTGACAAC GATGATGATGATGTTGTTGCCTCCTTCAACTCAACTTTCCTCCTGAACATTTACCGTAAC AAAGAGTGGAATGCCGGTGAAGGCTTTGCCTTTCTAATAGCTTCAGATATAAATATACCT GAACAAAGCCATGGACAGTGGCTAGGCCTCACCAATGCCAGCACTGATGGGAATGCAACA AACCACATCGTTGCTATAGAATTCGACACAGAAAAGCAGGATTTCGACCCCGATGACAAC CACATAGGCCTCAACATCAATTCTGTACACTCAAGCAAGAATGTTTCTCTCAAACCTTTA GGCATTGAGATATCGCCGGAGATAGCCACCAACTACAGCGTGTGGGTGGAATACGACGGT AGGTCCAAAGTCATGGAAGTCTACATGGCTAAACACTCTCGAGCCAACCCACCAAACAAG CCTAACACACCACTTTTGAGTGAGACAATAAACTTGAGGTATTACCTGAAAAAAGAGTCC TTCTTTGGATTTGCTGCTTCCACAGGCAGCCCAGCAATTCAGCTAAACTGTGTTTTGGAA TGGGATTTAAAAGTGGAGGAATTACACCCAAGAAAAGATTGGACTTGGTTGAAGATTGCT GCTGGGGTTGGTGTTCCAACTATGGCCTTGTTAGTGATACTTGGATTTTGGCTGGGAATT AGGTATGTGAACAAGAGGAAAATAACCAGGCTCACCATAATTCACCGGCTTCGACACAAA CATCTTGTACGGTTAGTAGCCCCTAGTGTACCTCCATTCAAGCCTGTTTTTATGTGGCCT TCCATGGGTGCTGCCTACAGCAGCACTGAGAGTACAGTTTCTAACGTCATTCTTTCTAGC ATTACAGTGTCTTACTAA
PEP MKIDKEISHPIHLQHKLKIEYTEIPFYCDGCKEPGIGLKYKCQKCEFDLHKACAVAAPNI HHPFYNKCEFQFLYNPPGAARRVCDVCRKDVLGFVYHCWRCDFDLHPCCANLPQVLDDGE HNLYLCLKLSGPCHRCGGKGPGWSYRSDCKTYNLHVSCVKELLVESWQAMYLNVDKNKVR EMQTRIPSLKGTLKNHHGGRGGGGKVRKCCQIAGGAVRVIVSAILGDPTALIGAVVGGFI SKNMGLPKGILITFLVVPFAIMLHQAAIGTAESAAKPKDFPFRVFDEKTDQAAFRFEGVS SIDQGALQLTPDTLNQAFLLPNRSGRIMYYRAYRLWLSDNDDDDVVASFNSTFLLNIYRN KEWNAGEGFAFLIASDINIPEQSHGQWLGLTNASTDGNATNHIVAIEFDTEKQDFDPDDN HIGLNINSVHSSKNVSLKPLGIEISPEIATNYSVWVEYDGRSKVMEVYMAKHSRANPPNK PNTPLLSETINLRYYLKKESFFGFAASTGSPAIQLNCVLEWDLKVEELHPRKDWTWLKIA AGVGVPTMALLVILGFWLGIRYVNKRKITRLTIIHRLRHKHLVRLVAPSVPPFKPVFMWP SMGAAYSSTESTVSNVILSSITVSY


| Top |