Cherry SNP DataBase

Gene information

Gene Pav_sc0000358.1_g300.1.mk
Chromosome name PAV_r1.0chr5
start 14920433
end 14921482
PAV_r1.0 name Pav_sc0000358.1
start 139519
end 140568
direction +
Annotation NR PREDICTED: uncharacterized protein LOC103338568
Sequence CDS ATGGAGGAGAAACAGTTTGATCCATCCGCCGGTCCACGTGGCGACACCCAAACCGGCCTT CATCAAGGGTTCAAGCACTACAGCGAAAGCCATCACAAACATAAAGAGAGAAACGCAGAG AGAGAGAGAAAGAGAGAGAGAGAGAGAGAGAGCATGGAGGTCAAAGCATTTTGTAGCAGC GTGAGAGGTGCGCCATTGAGAGGCAGAAGAGAGAATTATGCTTCTTCTTTCTCACCCCTC CTCATCCAATCCATGGCTACCCAGAAGCCCATTCCTTCTGTTAACAAAACAGTTAGCTCC AAGAAGAATTCAACTAAACCACCAGTTAAGCTACTAACAAGGGTGGAGCAACTGAAGCTA CTGACCAAAGCAGAGAAAGCCGGCCTGCTATCGGCGGCAGAGAAGTCCGGCCTCTCGCTG TCGAGCATAGAGAAACTGGGTCTGCTCTCCAAGGCGGAGGAATTCGGAGTTCTATCGGCA GCCACTGACCCAGGAACTCCGGGGACATTGTTCACTCTGAGCTTAGCATTGTTGCTTTTG GGTCCATTTGTAGTCTATCTTGTGCCTGAGGATTATCCTTTTGAGATAGGGGTACAAGCT TTTGTTGCTTTGCTTTCAGTGGTGGGTGGTTCTGCAGCTTTTGCTGCTTCAAATTTTGTA TCCAACTTGCAGAAGTCAAATTGA
PEP MEEKQFDPSAGPRGDTQTGLHQGFKHYSESHHKHKERNAERERKRERERESMEVKAFCSS VRGAPLRGRRENYASSFSPLLIQSMATQKPIPSVNKTVSSKKNSTKPPVKLLTRVEQLKL LTKAEKAGLLSAAEKSGLSLSSIEKLGLLSKAEEFGVLSAATDPGTPGTLFTLSLALLLL GPFVVYLVPEDYPFEIGVQAFVALLSVVGGSAAFAASNFVSNLQKSN


| Top |