Cherry SNP DataBase

Gene information

Gene Pav_sc0000359.1_g410.1.mk
Chromosome name PAV_r1.0chr1
start 4797035
end 4803104
PAV_r1.0 name Pav_sc0000359.1
start 252199
end 258268
direction +
Annotation NR PREDICTED: afadin- and alpha-actinin-binding protein A isoform X2
Sequence CDS ATGCCAGCCACTGACGCAGACTTCGATCTCAGACCGTCTCCTCAGTCCGCCTTCGCAATC GGAGAGTACGCATTTGCCGATGTCGGGAATTTAGAGCATTGTATTAAGTATTTGAATCAG ACCCTTGTTACCTTCGGATTCCCGGCTTCACTTGATCTCTTTGCAAATGATCCGGTTTCT GTTGCTCGGACTTGCAATTGTATGTATTCGTTAATTCAGCAGAGACAACGCGATGTCGAA TTTCGAGAGTCTGCTAACGAACAGAGACAGCGGCTATTGTCAGACATATCAAGATTAGAA GCTAAAGTTGAGAGGCTTGAGGGGCAGTTACAAGCCAAAGAGAGGGAGATAGCAACAATA ACACGAACGGAAGCTAAAGCTACAGCAGCTTTTAAGTCCCAAATTGACAAACTACAGCAG GAGCGCGATGAGTTTCAGAGGATGGTCATCGGCAATCAGCTACTATGTGAAAATGGACAA ATCCTGACAAGTATCAATGATCTGCTGATGCTGCCAAAGCAAGTTAGGACTCAACAAATG CATGAGATGAAGAAAAAAGAAAAGGAGTACATAAAGTTGCAGGAGAGGCTAAACCAAGTG TTGATGGAGAAAAAGAAGGAATCCAGATCAGGCATGGAGATAATGAATTTACTTCAGAAA GAAGGGCGGCAGCGTGGAACATGGAACGGAAAGAAGGCTGATAATGAATTTTATAAAAAG ATTGTGGATACTTATGAGGCAAAAAATCAAGAATTGATTGCAGAGAATGCTGATTTAAAG GCATTATTGCGATCAATGCAGGTGGATATGCGTGATTTCATAAATGCTCCAAATGGGCAA TCCAAGCAGTCTCTGGCTGCCAATGAACGAGTTGAAACTGACCACACACAGTCTCCATTG GGTGGGAGGACGGATGTCTTTGATCTGCCTTTTCACATGGCGAGAGATCAAATAGAAGAA AGTCTCCGAAATAAGATGGCTTCCATAAAGGAGCGCATGGTTCAATTGCAAGATGCACAA AAAGAAGCAGAGGTTACATCTGAAGTAACTGAGAGGGAGCTTGAGCTTGAAGCTCAACTT GTTGAGGCAAGGAGCATAATCCAAGAGCAGCGTCACCAGAAAAGTGCACAAAGCATCCAT AATGTCTAA
PEP MPATDADFDLRPSPQSAFAIGEYAFADVGNLEHCIKYLNQTLVTFGFPASLDLFANDPVS VARTCNCMYSLIQQRQRDVEFRESANEQRQRLLSDISRLEAKVERLEGQLQAKEREIATI TRTEAKATAAFKSQIDKLQQERDEFQRMVIGNQLLCENGQILTSINDLLMLPKQVRTQQM HEMKKKEKEYIKLQERLNQVLMEKKKESRSGMEIMNLLQKEGRQRGTWNGKKADNEFYKK IVDTYEAKNQELIAENADLKALLRSMQVDMRDFINAPNGQSKQSLAANERVETDHTQSPL GGRTDVFDLPFHMARDQIEESLRNKMASIKERMVQLQDAQKEAEVTSEVTERELELEAQL VEARSIIQEQRHQKSAQSIHNV


| Top |