Cherry SNP DataBase

Gene information

Gene Pav_sc0000359.1_g670.1.br
Chromosome name PAV_r1.0chr1
start 4608386
end 4609138
PAV_r1.0 name Pav_sc0000359.1
start 446165
end 446917
direction -
Annotation NR PREDICTED: LIM domain kinase 1-like
Sequence CDS ATGGACAAGTTTCTAAATGATATGGAAACAGAGAAGCTCATCAGGTTTACTACTCAACAA CTGCAGATAGCAACTGATAACTTCACCAATTTGTTGAGTTCAGGAGGTTTCGGTGCAGTT TATAAAGGGGTATTTGGCAATGGAACCCTTGTAGCAGTGAAGGTTCTAAATGGGAGCTCA GACAAGAGAATTGAGGAACAATTCATGGCAGAAGTTAGTACAATTGGAAGAATTCACCAT TTCAATCTGGTCCGTCTTTATGGCTTCTGCTTTGAGAGACATCTCAGAGCACTTGTTTAT GAGTGCATGCCAAATGGTTCCCTTGACAAGTTCTTATTCCATGGAAGCAAGATCTTAAGA TTTGAAAAGCTTCATGAAATTGTGATCGAGACAGCCAAAGGCATTGCTTACTTGCATCAG GAGTGTCAACAACGAATAGTCCACTACGATATAAAACCTGAAAATATTCTTTTGGATGCA AATTTGTTTCCAAAAGTAGCTGATTTTGGCTTGGCCAAGCTCTGTAACAGGGAAAATACT CATATAACCATGACAGGGGGCTGGGGGACTCCTGGCTATGCTGCACTAGAAGTTTGGCTG GGATTTCCTATAACACACAAATGTGATGTTTACAGCTTTGGGATGCTATTGTTTGAGATC ATAGGCAGGAGAAGGAATCTTGACATTAATATTCAAGTAGCCAAGATTGGTTCCCAAGGT GGGTATGGAAGAAGTTTGAACCTGGAGAGCTAA
PEP MDKFLNDMETEKLIRFTTQQLQIATDNFTNLLSSGGFGAVYKGVFGNGTLVAVKVLNGSS DKRIEEQFMAEVSTIGRIHHFNLVRLYGFCFERHLRALVYECMPNGSLDKFLFHGSKILR FEKLHEIVIETAKGIAYLHQECQQRIVHYDIKPENILLDANLFPKVADFGLAKLCNRENT HITMTGGWGTPGYAALEVWLGFPITHKCDVYSFGMLLFEIIGRRRNLDINIQVAKIGSQG GYGRSLNLES


| Top |