Cherry SNP DataBase

Gene information

Gene Pav_sc0000367.1_g030.1.mk
Chromosome name PAV_r1.0chr1
start 27534134
end 27537115
PAV_r1.0 name Pav_sc0000367.1
start 12063
end 15044
direction -
Annotation NR PREDICTED: neutral ceramidase-like
Sequence CDS ATGAAGACGAGAAGCAAAATTCAAGAGCAGCACTCGTCTGTGTTGTCATCACTTATTATT ATGATTATTGTGGGTATAGGTGTAATTAGGAGATGCAATGGCGAAGGGTATTTGATTGGA GTGGGAAGCTATGACATGACTGGGCCAGCAGCAGGGGTGAACATGATGGGTTATGCCAAC ATGGACCAGTCGACTGCCGGTGTACATTTCCGACTCAGGGCAAGGACCTTCATCGTCGCG GAGAGTTCCCAAGGTCCGAGGTTTGCCTTTGTTAATCTTGACGCTGGGATGGCTTCACAA CTCGTTAACATTAAAGTGCTGGACAAACTCAAATCAAGGTTTGGAGATTTGTATACGGAA GAAAATGTGGCGATTAGTGGGATTCACACTCACGCTGGACCAGGGGGTTATCTGCAGTAT CTGGTTTACTCTATAACATCTTTGGGGTTTGTCCAACAATCCTTCGATGCCATTGTGAAC GCAATTGAGCAGAGCATTGTTCAGGCTCATCACAACCTCAAGCCTGGTTCTGTTTTCATC AACAAAGGGGATGTGGTAAACGCGGGAATAAACAGGAGCCCAAGTGCTTATCTGCTAAAC CCGGCGGAGGAGAGAGCCAGGTATCCAAGCAACGTGGACACCCTCATGACTCTGTTGAAG TTTGTGGATGATGCAAGCGGGAACAGCGTTGGAGCCTTCAGCTGGTTTGCCACCCACGGA ACCTCCATGAGCAAAAACAACCTCCTCATCAGTGGAGACAACAAAGGTGCTGCTGCTCGA TTCTTCGAGGACAGGTTCTCCTCTTCCTCTTCGTCTACTACAAGCTACAACTCCTCCTCT ACCACACCAGCTGATAGTAGCGCGTTACTATTATCACTAGTAAAGAAGGCACAAAGCATG AAAGCCACGGGAGGAAAGCTCTGCGGTAAAACAAGCAGCCGAAAGTCTAAGGTGAGGAAG AACAACGGGTCGCTGTTCGTGGGAGCTTTTTGCCAATCAAATGTTGGGGATGTGACCCCA AACGTGCTTGGAGCTTTTTGCACCGATTCTGGAAGACCCTGCGACTTCAATCACTCCTCC TGTCATGGGAACGACCTGCTTTGCCTGGGCCAATTCACCACAATGGCGGGCCGGCGGCTA AGGGAAGCAGTCAAGGAGACATTGATAAGTAACAGCAATGGTGAATTTGATGACGAAACC CACATTGTAATAGCAGGCCTCACAAATACTTATTCCCAATATATTGCAACTTTTGAGGAA TACACGCAACAGCGATATGAGGCTGCTTCCACTCTCTATGGTCCTCACACGTTATCAGCA TACATCCAAGAATTTGAGAAATTAGCCAAAGCAATGGCGAAGGGAGAAAAAATCACTAAA GGTCCCTCACCACCAGATCTTTCCTCT
PEP MKTRSKIQEQHSSVLSSLIIMIIVGIGVIRRCNGEGYLIGVGSYDMTGPAAGVNMMGYAN MDQSTAGVHFRLRARTFIVAESSQGPRFAFVNLDAGMASQLVNIKVLDKLKSRFGDLYTE ENVAISGIHTHAGPGGYLQYLVYSITSLGFVQQSFDAIVNAIEQSIVQAHHNLKPGSVFI NKGDVVNAGINRSPSAYLLNPAEERARYPSNVDTLMTLLKFVDDASGNSVGAFSWFATHG TSMSKNNLLISGDNKGAAARFFEDRFSSSSSSTTSYNSSSTTPADSSALLLSLVKKAQSM KATGGKLCGKTSSRKSKVRKNNGSLFVGAFCQSNVGDVTPNVLGAFCTDSGRPCDFNHSS CHGNDLLCLGQFTTMAGRRLREAVKETLISNSNGEFDDETHIVIAGLTNTYSQYIATFEE YTQQRYEAASTLYGPHTLSAYIQEFEKLAKAMAKGEKITKGPSPPDLSS


| Top |