Cherry SNP DataBase

Gene information

Gene Pav_sc0000370.1_g790.1.mk
Chromosome name PAV_r1.0chr5
start 6995291
end 7001107
PAV_r1.0 name Pav_sc0000370.1
start 375543
end 381359
direction +
Annotation NR PREDICTED: maspardin-like
Sequence CDS ATGAAAGGCGTCAACTCGGCGCCCGGAGATTACATCTACTTCAAGTCCCAGGTCCCTCTT CACAAGATCCCAATTGGCACAAAACAGTGGCGATACTATGATTTTGGCCCAAAAGCAGTA CCTCCACTTATTTGTCTTCCCGGAACAGCAGGGACAGCTGATGTCTGCTACAAGCAGATC ATGTCGTTGTCCATGAAGGGTTATCGGGTGATTTCTGTTGATATTCCACGTGTATGGAAT CATCATGAGTGGATCCAAGCATTTGAGAAATTCTTGGATGCTATCGATGTTCATCATATA CATATTTATGGTACATCCCTTGGGGGCTTCTTGGCTCAACTTTTTGCTCAGCATCGTCCA AGACGAGTTCGATCATTGATACTATCAAACACATTTTTGGACACGCGCAGTTTCTCTGCA GCAATGCCATGGGCTCCCATATATGTCTTGACCGGAATTCGTGATGGCCCCCATGAGCCA TTTATTGCTGATTCGGTGGACTTCGTTGTTTCTCAGGTTGAAACGCTCTCAAGAGAAGAC CTGGCCTCCAGGTTAACTTTAACAGCTGATGCTGCCTCAGTTGGACCTCTGTTGCTTACA GACTCATTCATTACTATAATGGATACAAATGACTACAGTGCGATTCCTCAACAACTCAAA GATGAAGTGAGTGAGAGGTACCCTGGTGCAAGGCGAGCACAATTGAAGACTGGGGGAGAT TTTCCATTCCTTTCACGGCCAGATGAAGTAAACTTACATCTTCAGCTACATCTAAGACGG GTTGGTGTGGAGGCTCGACCTGATTTGGTTCCAGGCATTCCAAAGGGGGGTAGTGGTGGG AGTTCTAGTGAAGAGAATGAGAAAAAAGATCCAGAAGATCCCGCCAACGATGAAGATCCA GCCAACGATGATAGGGGAAGCTCAGACAATCCTTTGGCAGAAAGTCAGCTACCTCATGCT CCAGAAAGTTCACAATCTCATAGCTTAGGTGACCAGCTTGTCAGCAATGCAATAGTTTGC CACTTCAGTAATGTACACATGATGGTTTATTTGCATTCGGGATTCTTGAAGAATCAGCAT ACTATACCCACTGAAACTGTTATGCGACTTTGTGCGGAAATATTTGCTCTTCATTTGCTT TCTTTTTATGTGGGATCATTGTACATTAGTTTGAACTGTAATCGGAGGGTCGGACAAGTC GTGTAA
PEP MKGVNSAPGDYIYFKSQVPLHKIPIGTKQWRYYDFGPKAVPPLICLPGTAGTADVCYKQI MSLSMKGYRVISVDIPRVWNHHEWIQAFEKFLDAIDVHHIHIYGTSLGGFLAQLFAQHRP RRVRSLILSNTFLDTRSFSAAMPWAPIYVLTGIRDGPHEPFIADSVDFVVSQVETLSRED LASRLTLTADAASVGPLLLTDSFITIMDTNDYSAIPQQLKDEVSERYPGARRAQLKTGGD FPFLSRPDEVNLHLQLHLRRVGVEARPDLVPGIPKGGSGGSSSEENEKKDPEDPANDEDP ANDDRGSSDNPLAESQLPHAPESSQSHSLGDQLVSNAIVCHFSNVHMMVYLHSGFLKNQH TIPTETVMRLCAEIFALHLLSFYVGSLYISLNCNRRVGQVV


| Top |