Cherry SNP DataBase

Gene information

Gene Pav_sc0000372.1_g070.1.mk
Chromosome name PAV_r1.0chr6
start 10127955
end 10140325
PAV_r1.0 name Pav_sc0000372.1
start 18380
end 30750
direction +
Annotation NR PREDICTED: uncharacterized protein LOC103327070 isoform X1
Sequence CDS ATGGCTGCGACTTCCAGTGGTTCCAATGTATATTTGCCCAAGTTTGAGTATAAAGTTGAT GGTGTTGGTTGGTCGGATGAGCTTGACTATCTTCCATTGATACGACGGCGTGATTTGTTA CTGGCCAGTAATCTAAAATCAAAATCCCTCATTGGTGCTGCTCTTAAAGAAGACGATGAG CTCTCTGAGTCACAATTAGAATCTGGTGGAAATGAAATCCAAGAAAGCAACAAAGCCCCT TCTGAGATGAAGACCAACAGGTTTCATAATGCAGCATGTAAAACTGTGGTAAATTCCTCA CTTGATCAATGTTTACAAAATGACGTTTGCAGCCAAAATGTGGAAATGCCTTGTGATAGT GACTACAATGGGACAGAAGTAAATAGTTTAACTTCCTCAAAGCAGATTGCCTGTACTGAA TCTGATACAAATGTTGGTCAACCAGAGAAAATTGATGTCAATATTTTCACTCTACCTGAA AATCCATCACTATCAGAAGTTCATGCTGAAGAAAAGGCTGCTTCCTCTGGCAGCTTGTTG AGTTCTTTTGGAGATGGTATGAATTGCTTTGCTGGTTCTCCTGTGTCAGCAGTTAAGGTG AAAAGGGAGATGTCTGATCACTGTACTTATGATCCTCTGGACCACATTTCCTTGAAAGAG CGACAGAAGATGCTGCAATCAAGGAAACTCTCGGGTATGGAAAAAGCAGTTTTCAAGGGT ATTCCAGGTTCACTGTCAAAAGACCTTATCCAACAACTTGCCGATAAAGGACAAGGAGAC ACCAGTAGTGTCGGTGGAGAAGCTTTAGTTGCTACCCATTCGCTCTATGACAATCCTGCA AGAAATGATTTAGTTCTTTGTAGAAATTCTATGATTAGATTGCCAAATAAAATCATTGTT GGATCATCATTTACGACTGATCAATATTCAATTAACTCCAATAAGTCAAATGATGGCGGA AAAGGATCTGAAAGTGACAGGAAATGCTCATCTGAGAGAATGCCTCCTAATGCCAATGAA TTCAGTTCATGTGGGGGACAGGACTATGTGCCTATGTGCACAACTAGAGCACATTGTTCA ACTTTGTCAACATCTGTCAAAATAAAGGATGAGCCTTGGGATGGTGGTGTCTTGCACAAT CTGGACACAAATGTTAGGGGTAACTTCTCCCTTAACATACTGCCAGTAAAGAATGAACCT AGAGCTTTCAATGAACTTAATGAAGATGTGGTAGATCATATGACACTGCGAGATCGGATG AATCTGTTGTCATCTGGATGTGGCTCTGTATCGAGTATGTATACGAACTATGGCTCAGCC AAGTGTAGCGCTATTGCCTCAGAATCTGCTAAGCCAATAAGCCTCATTCGTCCGCGAAAA AGGAAAAAGACTGCCACGGATTCTGTTGAAACAGCGTTGGAGGAGGATGCTCCAGGACTC CTGCAGGTATTAATTGAAAAAGGGGTGCTGGTTAATGAAATAAGGCTTTACGGCGAGATG GAGTGTGATGAAGCTCTAGACGAGTCTTTATGTGAAGACAGCTTTGCAAAGCTTGAAGCT GTGATATCAAAGATCCAAACAGAGTACATCAAGCCCAAGTGGCTGTCTCCTCACACGATC TCTGTGGTTGAGACTGAGTTGGACGAGTTAGTATTTGTGCTGTCGGAGAGTTTGGGTGAG GAAGGGAAGATGACAGTGGCAAAGGAATGGAAACCACCGGAGTTGAAGCCCAAGAGATCA CAGACTGGGGTTAAGATGGCGACTGGTTTGGCTTCTGTCATGCTTATATCACAGCGCCAA TCGATTTTAAAGCTTGCTCCAATACGATGCACAAAGGGCTCAAGAGCTGGTTATTGCTTG GCTTGTTTAATTTCACTTGTGGAGCAGGTTGGTCCATCTTCTCTACTTAGACTGGATATT TTTGACATTTCATTATCACTTGACTGCAGAATTGTGCTGGAACGACCTGAATATGGATAT GCAACATACTTCTTTGAGCTAGTGGATTCCTTACCAATTGACTGGCAGATCAAGAGGCTG GTGACTGCAATGAAGCTTACCAACTGCAGCAGGATTTCCCTAATTGAGAACAAGGCATTA TTGGTTGGAGAAGACTTGAGTGAAGGCGAGGCTCAGGTGCTAACAGAATACGGTTGGGAA CCCAATACTGGCTTGGGAACAATGCTCAAGTACTGTGACAGAGTTGTTCATGACAGGAAG AATGAAACTGATAGCTCGGAGTGGAGATCAAAAATAGGAAAGTTGTTAATGGATGGTTAT AATGGTGGGGCTCTGATTGCAAGCAACATCCCTAAGAAGGTTCTCGAATGCAGAGATGTT CAAAGCCCCGAAATCAAGTTGGAGCTCTAA
PEP MAATSSGSNVYLPKFEYKVDGVGWSDELDYLPLIRRRDLLLASNLKSKSLIGAALKEDDE LSESQLESGGNEIQESNKAPSEMKTNRFHNAACKTVVNSSLDQCLQNDVCSQNVEMPCDS DYNGTEVNSLTSSKQIACTESDTNVGQPEKIDVNIFTLPENPSLSEVHAEEKAASSGSLL SSFGDGMNCFAGSPVSAVKVKREMSDHCTYDPLDHISLKERQKMLQSRKLSGMEKAVFKG IPGSLSKDLIQQLADKGQGDTSSVGGEALVATHSLYDNPARNDLVLCRNSMIRLPNKIIV GSSFTTDQYSINSNKSNDGGKGSESDRKCSSERMPPNANEFSSCGGQDYVPMCTTRAHCS TLSTSVKIKDEPWDGGVLHNLDTNVRGNFSLNILPVKNEPRAFNELNEDVVDHMTLRDRM NLLSSGCGSVSSMYTNYGSAKCSAIASESAKPISLIRPRKRKKTATDSVETALEEDAPGL LQVLIEKGVLVNEIRLYGEMECDEALDESLCEDSFAKLEAVISKIQTEYIKPKWLSPHTI SVVETELDELVFVLSESLGEEGKMTVAKEWKPPELKPKRSQTGVKMATGLASVMLISQRQ SILKLAPIRCTKGSRAGYCLACLISLVEQVGPSSLLRLDIFDISLSLDCRIVLERPEYGY ATYFFELVDSLPIDWQIKRLVTAMKLTNCSRISLIENKALLVGEDLSEGEAQVLTEYGWE PNTGLGTMLKYCDRVVHDRKNETDSSEWRSKIGKLLMDGYNGGALIASNIPKKVLECRDV QSPEIKLEL


| Top |