Cherry SNP DataBase

Gene information

Gene Pav_sc0000375.1_g660.1.mk
Chromosome name PAV_r1.0chr6
start 1504092
end 1507490
PAV_r1.0 name Pav_sc0000375.1
start 376009
end 379407
direction +
Annotation NR PREDICTED: uncharacterized protein At1g18480 isoform X1
Sequence CDS ATGGCTTCGCTCTGTCTGAACTCGTTGCCTCTGCCTCCACCTTCCCAACCCCCCAAACTC TCAGAGGCTCCTTCACCTTCTTCTAATTCTCTCAACATTAATAGTTATTATGGCAGCAAA GGAGAAACCTCAAAGCCCATAGTTGTCAGTGGAAACCCACCCACCTATGTTTCTGCTCCT GGTCGCCGAATTGTCGCTGTTGGGGATCTGCATGGAGACCTTGACCAAACAAGATGTGCA CTTGAGATGGCTGGTGTGCTGAGTCCTGATGGTCAGGACTTATGGACTGGTGGAGAAACG GTATTGATTCAGCTTGGAGATATACTTGATCGAGGTGAAGATGAAATAGCTATTTTGTCC TTGCTCCGATCCTTGGATATACAGGCAAAAGATGAAGGTGGAGCAGTTTTTCAGGTCAAT GGGAATCATGAGACTATGAATGTGGAAGGGGATTTTAGATACGTGGAAACTGGAGGATTT GATGAGTGTATTGATTTCCTGGAATACTTGGATGACAATAGAGATGACTGGGAAGAAGCT TTTGTTGGCTGGACTGGTGTCTCTAAACAGCTGAAGGAAGACAGGAAAATGCCCCTAAAT CATTGGGATCCATGGAATCTAGTGAGGAGGCAAAAGGGTGTGATTGCCAGATCAATCCTT CTAAGACCAGGTGGTCCATTGGCATGCGAGTTAGCACGGCATGCTGTTGTTCTTAAGGTT AATGACTGGGTCTTCTGTCATGGTGGTCTTATTCCTAACCATGTTGCATATGGCGTAGAG AGGATGAACAGGGAAGTATCTCACTGGATGAGAGGCCTCAGTGACAGTGATGAGTCTGAC AACCCTCATTTCCCTTTCATAGCCACCAGGGGCTATGACAGTGTAGTCTGGAACCGCTTA TACTCGAGAGATACTTCAGAATTAGATGACTATCAGAACAACCAGGCAAAGACGCTACAC GCCGTTGGTGCTAAGGCAATGGTGGTGGGGCATACTCCTCAAACTACAGGAGCAAATTGT AAATACAATTGCAGCATATGGAGGATCGATGTAGGGATGTCCAGTGGAGTTCTTAATTCA AGACCAGAGGTTCTTGAAATCAAAGACAATAAAGCAAGAGTTATAAGAAGCAAAAGGGAG ACGTCCAGTGAATCTCAGGTTGTCGATTTTATATAG
PEP MASLCLNSLPLPPPSQPPKLSEAPSPSSNSLNINSYYGSKGETSKPIVVSGNPPTYVSAP GRRIVAVGDLHGDLDQTRCALEMAGVLSPDGQDLWTGGETVLIQLGDILDRGEDEIAILS LLRSLDIQAKDEGGAVFQVNGNHETMNVEGDFRYVETGGFDECIDFLEYLDDNRDDWEEA FVGWTGVSKQLKEDRKMPLNHWDPWNLVRRQKGVIARSILLRPGGPLACELARHAVVLKV NDWVFCHGGLIPNHVAYGVERMNREVSHWMRGLSDSDESDNPHFPFIATRGYDSVVWNRL YSRDTSELDDYQNNQAKTLHAVGAKAMVVGHTPQTTGANCKYNCSIWRIDVGMSSGVLNS RPEVLEIKDNKARVIRSKRETSSESQVVDFI


| Top |