Cherry SNP DataBase

Gene information

Gene Pav_sc0000375.1_g720.1.mk
Chromosome name PAV_r1.0chr6
start 1475858
end 1488250
PAV_r1.0 name Pav_sc0000375.1
start 395249
end 407641
direction -
Annotation NR PREDICTED: UDP-glycosyltransferase 87A1-like
Sequence CDS ATGCCTATCTCCTTTTACACGCTTGACCATCTTCTTAGGACTCTCGAGCCTCCTTCCGAC GTCTCCCCAAACCCAAACCAATCCAATCCAATGGCCCTCTCAAACCCCTCATCAATCACC ACACGCCATGTGGTGGCGCTGCCATTCCCCGGCCGCGGCCACATCAACCCCATGATGTGC CTCTGCAACTCCCTCGCTTCGCTAAAGCCGGCCGCCGACAACACCGACATCATCGTCACC TTTATCGTGACGGAGGAGTGGCTCGGCTTCCTCTGCTCGGAGCCGAAGCCCGACAACGTG AGCTTCGCTACTATTCCCAACGTCATCCCCTCCGAGATCGGTCGCGGCGCTGACTCTCCG GGATTCTATGAGACCGTTTTGAGAAAAATCAAAACCCCGGTCGAAGACCTCCTCGACCGA CTCGAGCCGCCAGTCACCGCCTTGATCGCCGACACGTACTTGGTCTGGTCCGTCGAGATC GGGAATGTGAGGAATATTCCTGTAGCTTCTCTATGGACCATGTCCGCTTCTGTCTACTCC GTCTTCCATTTCTTCGATCTCGTCGTCCAACACAGTCATTTTCCCGCTAATTTGGACGAG CATGTGGACTACATCCCGGGACTTCCTTCCACACGTGTGGCGGACCTTCCCACGTGTTTC TATGGGAAAGGGCTTAATGTATTGGATCGAGCACTAGAATCCGTTGCATCGGTGTCCAAA GCCCAATGGCTTTTGTTGCCTTCGGTGTATGAGCTTGAAGCCCAAGTGATCGACGCTCTG AGGGCAAACGCATCGATCCCAGTTTATCACATTGGGCCCACCATACCCCATTCCAAGGTG GAGGCCGAATCAAGGCCCAGTGAGGCCCACTATTTTGATTGGCTGGACAAACAGCCTACT GGGTCAGTTTTGTACGTGTCGCAAGGTAGCTTGCATTCAGCTCCCAAAGCCCAAATGGAT GAAATCGCTGATGGGTTGAGGGAGAGTAGGGTTCGATTCTTCTGGGTGGCGCAAATGGCC ACAGCAAAACTTGAGCCAATCCCCGTCTGCCATGTGGTGGCCCTGCCTTATCCCGACAGA GGACACATCAACCCCATGATGAACCTCTGCAAATCACTGTCTTCAAAGAAACCCGACAAC ACCCTTGTCATCACCTTCGTCGTCACCGAAGAGTGGCACGGCTTCATCGGATCCGACCCA AAACCCTACAACATCCGGTTTGCGACGCTACCAAACGTCATCCCGTCCGAGCTAACGACT TTTCGGCGTTCGTTGAGGCCGCGAACACCGCACTGGAAGCTCCCTTCGAGCGGCTTCTGG ATGGGCTCGAGGCTGAGGCGCCTCCACTTTGAGCTGCTCAAACAGCAAGGTCACTTCCCT GCTGACGTGTCAGAGCGTGGAGATGAGATAATAGACTACATCCCTGGAATCAACACCACA AGCGTTGCAGATCTTCCCACGGTATTCTTTGGAGACAATCATCAAAAAGTCCTCCACAGA GCTATTGAAACTGTTGCTCAAGTAGTAGAAAAAGCACAATATCTTTTGTTCACTTCAGTC CATGAGCTTGAACCTCAAGTCTTTGACACTTTCAAAACCAATTTGTTCTGCCTGTCTACC CTATTGGCCCAACCATACCTCACTTTGAACTTTCTAAAAAGAGAAAATGGGAACAGTAAA AGACAACCACATCTCAGTCTGCCACGTGGTGGCGCTGCCCTATCCCGGCAGAGGCCACAT CAACCCCATGTTGAACCTCTGCAAACTTCTATCCTCAAAGAAACCCGACAATACCCTCCT CATCACCATCGTCGTCACCGAGGAGTGGCACGGCTTCATCGGATCCGACCCGAAACCTGA
PEP MPISFYTLDHLLRTLEPPSDVSPNPNQSNPMALSNPSSITTRHVVALPFPGRGHINPMMC LCNSLASLKPAADNTDIIVTFIVTEEWLGFLCSEPKPDNVSFATIPNVIPSEIGRGADSP GFYETVLRKIKTPVEDLLDRLEPPVTALIADTYLVWSVEIGNVRNIPVASLWTMSASVYS VFHFFDLVVQHSHFPANLDEHVDYIPGLPSTRVADLPTCFYGKGLNVLDRALESVASVSK AQWLLLPSVYELEAQVIDALRANASIPVYHIGPTIPHSKVEAESRPSEAHYFDWLDKQPT GSVLYVSQGSLHSAPKAQMDEIADGLRESRVRFFWVAQMATAKLEPIPVCHVVALPYPDR GHINPMMNLCKSLSSKKPDNTLVITFVVTEEWHGFIGSDPKPYNIRFATLPNVIPSELTT FRRSLRPRTPHWKLPSSGFWMGSRLRRLHFELLKQQGHFPADVSERGDEIIDYIPGINTT SVADLPTVFFGDNHQKVLHRAIETVAQVVEKAQYLLFTSVHELEPQVFDTFKTNLFCLST LLAQPYLTLNFLKRENGNSKRQPHLSLPRGGAALSRQRPHQPHVEPLQTSILKETRQYPP HHHRRHRGVARLHRIRPET


| Top |