Cherry SNP DataBase

Gene information

Gene Pav_sc0000376.1_g140.1.mk
Chromosome name PAV_r1.0chr4
start 22295320
end 22301968
PAV_r1.0 name Pav_sc0000376.1
start 53942
end 60590
direction +
Annotation NR hypothetical protein PRUPE_ppa016592mg
Sequence CDS ATGGTTGACCTGTTTGACCCCGTAGTCCGACGAGTTGATGGTATTGCTGGAGAGCGTGTA TCAATGAGGGTTGATTTGGAGTGCTCTGACGGGCGCAATACAGTTGGCATATTCAGTCAC AAGAGACTCTCCGTATCAGTTGGAAATGCAACAGCTGCATTTGTTCTGGCAATTCTTGAG GGAAGCACAAAGCCTGGGGTTTGGTTTCCAGAGGAGACTGAAGGCGTTGCAATCGAGGCA AGAAAACTCCTTCTCGAACGTGCTGCACAAGGAACATTCAATTTTGTAATGAACAAGCCA TCATGGATGGTGGAAACAAATCCAAAAGAGTTAGGGTTGGGAATATACGTGTAA
PEP MVDLFDPVVRRVDGIAGERVSMRVDLECSDGRNTVGIFSHKRLSVSVGNATAAFVLAILE GSTKPGVWFPEETEGVAIEARKLLLERAAQGTFNFVMNKPSWMVETNPKELGLGIYV


| Top |