Cherry SNP DataBase

Gene information

Gene Pav_sc0000376.1_g800.1.mk
Chromosome name PAV_r1.0chr4
start 21855892
end 21862280
PAV_r1.0 name Pav_sc0000376.1
start 493630
end 500018
direction +
Annotation NR cinnamoyl-CoA reductase 1
Sequence CDS ATGAGCAGCGGGGCTGGCAAGGTCATCTGCGTCACCGGTGCGTCCGGTTACATTGCTTCA TGGCTCGTGAAGCTTCTTCTTCAAGGCGGTTACACTGTCAAGGCCTCTGTTCGCGACCCA AATGATCCAACTAAGACAGAGCACTTGCTTGGGCTTGATGGAGCTCAAGAGAGACTTCAA CTTTTCAAAGCAAATCTATTGGAGGAAGGTTCTTTTGACTCTGCTGTTGAGGGTTGTGAA GGGGTTTTCCATACTGCTTCTCCCTTTTATCATGATGTCACAGATCCAAAGGCAGAACTA CTTGACCCTGCAGTAAAGGGAACCCTTAATGTTCTTAATTCGTGTGCGAAATCCCAGTCT ATCAGACGGGTGGTCTTGACATCTTCGATTGCCGCAGTTGCATATAACGGAAAACCTCGA ACTCCTGATGTAGTTGTTGATGAGACTTGGTTTACTGATGCAGATGTTTGTAAGGAATCA AAGCTATGGTATGTGCTTTCAAAGACTTTGGCTGAGGACGCTGCCTGGAAATTTGTAAAG GAGAAGGGTATTGACATGGTTACAATTAACCCTGCAATGGTGATTGGTCCTCTGTTACAG CCAACACTTAATACAAGTGCTGCAGCAGTTTTGAATGTTATTAAGGGGAGCTCGAACATT TCCCAATGCAAGTTTTGGATGGATTAA
PEP MSSGAGKVICVTGASGYIASWLVKLLLQGGYTVKASVRDPNDPTKTEHLLGLDGAQERLQ LFKANLLEEGSFDSAVEGCEGVFHTASPFYHDVTDPKAELLDPAVKGTLNVLNSCAKSQS IRRVVLTSSIAAVAYNGKPRTPDVVVDETWFTDADVCKESKLWYVLSKTLAEDAAWKFVK EKGIDMVTINPAMVIGPLLQPTLNTSAAAVLNVIKGSSNISQCKFWMD


| Top |