Cherry SNP DataBase

Gene information

Gene Pav_sc0000379.1_g080.1.mk
Chromosome name PAV_r1.0chr8
start 1297808
end 1299469
PAV_r1.0 name Pav_sc0000379.1
start 60843
end 62504
direction -
Annotation NR PREDICTED: DEAD-box ATP-dependent RNA helicase 47A
Sequence CDS ATGCCGGCATTAATCTCGCCAAGGTTGCTCCTTTTTGGAGAGTCTCTATCCTTCCATAAG TTTCCACATGTTTCTAGGAATGCTTGGTTCCATAGAAGTGTTTGTAGTCTGAGTCTTGCA AGCCTCGGCTTCAAAAATGATCACGAAACAGTAGAGACTGGAAAATTCAACGAAGCCAAG CTGCTGAATTCTCTTACAGAAGTCCCCAAAAGTAAAGCCAAGGTGGTTAGAAGCCATGTA GTCAAGGCAGCTGGGCCACACAGATCGCTTGAAATAGATTCGACGATCTTTAATGCTAAA TCATTTTTCGAGCTTGGGCTTCCACCTTTGTTGATAGAGAGGTTAGAGAAGGAAGGCTTC AAAACTCCAACTGATGTTCAAGCCACTGCAATTCCAACAATTCTTAAAGATCATGATGTT GTGATTCAATCTTACACAGGCTCAGGAAAAACATTGGCCTATCTTCTTCCCATCCTCTCT GAAGTTGGCCCGCTAAAGACGATAACATCTGATGGTGATGGTGATGGTGATGGTGAACCT GGGAAGAAAACAGACATAGAAGCAGTAATTGTGGCTCCTTCGAGGGAGCTGGGTATGCAA ATTGTGAGAGAGTTTGAGAAGATATTAGGACCTGCAAACAAAAAAGTAGTTCAGCAGCTT GTAGGAGGTGCAAATCGATCAAGACAGGAAGAAGCACTGAGGAAAAATAAACCTTGCATT GTTGTTGGGACCCCGGGAAGGATTTCGGAGATTAGTGCAGCTGGGAAGCTTCACACCCAC GGCTGCCGTTTCTTGGTCTTAGATGAGGTTGATCAACTGCTTTCATTTAATTTTCGGGAG GACATGCACCGGATATTGGAACATGTTGGGAGGAAATCCAGTGGAGACTCACGTGGACCT AAAGGCTCCCTTGCCAAGCGGGCTGAGCGTCAGACTGTTCTGGTTTCTGCCACAGTACCA TTTTCAGTGATACGGGCAGCCAGGAGCTGGGGGCACGATCCACTTCTCATCCAAGCAAAA AAAGTCATTTCCATTGAATCTATTTCTCCCTCTGGACCCATTAATTTGTCAGGACAGTCA ACCAGTTCTGATCCATCCTCAAATGTGCAGACTCAGGCTGCAATACAGAGCCTACCTCCA TCTCTAAAACACTACTACTGTGTTACAAAGTTACAACACAAGGTTGACACGTTGAGAAGA TGTGTTCATGCTCTTGATGCCAAGTCCGTTATTGTCTTCATGAACCACACCAAGCAACTA AAAGATACCGTCTTCAAGCTGGAGGCTCGTGGAATGATAGCAGCAGAGCTACATGGCGAT CTTGGTAAACTTGGTAGGACAACAACTCTTAAAAAGTTCAAGAATGGGGAGGTTAGAATT CTGGTGACAAATGAACTTTCAGCCAGGGGTTTGGATGTGGCAGAATGTGATCTTGTAGTC AATCTGGAGTTACCCACTGACTCTATTCATTATGCACATCGAGCTGGTCGGACTGGTCGG CTTGGCAGGAAGGGCACTGTCGTAACAATATGCGAAGAGTCGGAAGTTTTTGTCGTGAAG AAGCTGCAGAGGCAGCTTAGCGTTCCAATTGCAACTTGTGAGTTCACAGAGGGCAAGTTT GTTATCACCAAAGAAGAGAAGGCTGTACCAGCTCTGAGGTGA
PEP MPALISPRLLLFGESLSFHKFPHVSRNAWFHRSVCSLSLASLGFKNDHETVETGKFNEAK LLNSLTEVPKSKAKVVRSHVVKAAGPHRSLEIDSTIFNAKSFFELGLPPLLIERLEKEGF KTPTDVQATAIPTILKDHDVVIQSYTGSGKTLAYLLPILSEVGPLKTITSDGDGDGDGEP GKKTDIEAVIVAPSRELGMQIVREFEKILGPANKKVVQQLVGGANRSRQEEALRKNKPCI VVGTPGRISEISAAGKLHTHGCRFLVLDEVDQLLSFNFREDMHRILEHVGRKSSGDSRGP KGSLAKRAERQTVLVSATVPFSVIRAARSWGHDPLLIQAKKVISIESISPSGPINLSGQS TSSDPSSNVQTQAAIQSLPPSLKHYYCVTKLQHKVDTLRRCVHALDAKSVIVFMNHTKQL KDTVFKLEARGMIAAELHGDLGKLGRTTTLKKFKNGEVRILVTNELSARGLDVAECDLVV NLELPTDSIHYAHRAGRTGRLGRKGTVVTICEESEVFVVKKLQRQLSVPIATCEFTEGKF VITKEEKAVPALR


| Top |