Cherry SNP DataBase

Gene information

Gene Pav_sc0000396.1_g1010.1.mk
Chromosome name PAV_r1.0chr6
start 23338209
end 23340839
PAV_r1.0 name Pav_sc0000396.1
start 457539
end 460169
direction -
Annotation NR PREDICTED: receptor-like protein kinase ANXUR1
Sequence CDS ATGCGCATCAAAACACACATCGTATTTTTTATTTCTTTTGTGTCTGTGTTCCTGAATGGC CTCCATGCTGCAAACTCGGACTCAGATTCATTGATCCTTGGCTGTGGCTCGGAGAATGAG GCCAAAGATGCAGATGGGAGGAAATGGCAACCAGACTCAAAGTACCTTACTGGATCTAAG GGAAGTCCGGCTCAAGCCCAATACCAGGACCCCGCACTTCTTTCTGAGGTTCCATACATG AAAGCCAGGATTTTCACCTCAAATGCCACATACAAGTTTCCAGTGAAACCCAAGCAGCGC TACATTATTAGACTCTATTTCTATCCGGCTGTTTATGGCAGCAACAATGCTGAGCAGTCC TATTTTGCGGTCATCGCCAATGGAATCACTGTCCTGCAAAACTTTAGTGCTTCAATCACT TGTAAGGCCCTTACGCAAGCTTATATCATGAGGGAGTATTTCCTGGCTCCCCTGAATAAG GATTCTCTAGAGGTCACCTTTTCGCCTTCCGCGGGCTTTGCTTTTGTGAATGGTATTGAG CTGATTGGAACGCCTGACATGTTCGGCAGCGCCACAATTGTCGGGGCTTCAGACCAGACT TTTGATGGCAAGAGTACAAATTTGCAGACCATGTTTAGAGTGAATATTGGTGGGCAGTTT ATTTCACCCACCAATGACTCTGGCGCCCTAAGCAGGACATGGTATGATGACTTTGCTTAT GTATTTGGTGCTCAACTTGGGGTCACTAACGAGGCCGCCAAAGATGTTAAAATTGACTAC AAAGATATGCCAGGATATATTGCTCCTGTTGATATCTACAAGACCTCAAGATCCATGGGA GAAAAGAAGGACATCAACCTGAGTTACAATCTCACGTGGGTGTTCAACCAGGTTGATCCT AAATTCATGTACCTTGTGAGGTTACACTTTTGTGACTTTTACCTCAGCAAAACCAATCAG ATAGTGTTCACTGTTTACATCAACAATCAAACTGCGGAGGCTGAAGCAGATGTGATCGGA TGGACAGGAGGAAAGGGGGTGCCTACATACAGAGATTATGTGGTAGCACTCAAGGATGGT AGTGATGGTAACCTTTGGCTAGCTTTGCATCCTGCAACGAAATCCCGTCCTGAGTTCTAC GATGCACTTATCAACGGAGTGGAGATATTCAAGCTTGAACAGGGTAAAACTTTGGCAGGA CCTAACCCTAACCCTTCTGAAATGTTGGCAAAGGACCAGGAAAGAGAGAGAAGCTTTGAA AATCAGCAGCAGCAGGGAGGAAGTGGAACCAACAAAGCTCATGTGATTGGTGGAGCTGCT GGAGGAGCTGCAGCCTTTGGCATAGTGGCTGCATTGTGCATTGCTGTGTACCAAAGAAAG AAAAAAGCCCTAGGAACCGAAACACACACTTCTAGCTGGCTACCACTCTATGGCAATTCA CATACCAGTGGCACCAAATCAACAATTTCAGGCAAGAGTACTGCTAGCAGCCACCTCACA ACAGCTGCTCAAGGCCGTTGCAGGCAATCCAACAACAACAACAACACCAACTCAAATGAA ACCACCGGCGACTCCAGCGCAATCTTCTCGCAGATTGTCAATCCAAAAGGGCGATGA
PEP MRIKTHIVFFISFVSVFLNGLHAANSDSDSLILGCGSENEAKDADGRKWQPDSKYLTGSK GSPAQAQYQDPALLSEVPYMKARIFTSNATYKFPVKPKQRYIIRLYFYPAVYGSNNAEQS YFAVIANGITVLQNFSASITCKALTQAYIMREYFLAPLNKDSLEVTFSPSAGFAFVNGIE LIGTPDMFGSATIVGASDQTFDGKSTNLQTMFRVNIGGQFISPTNDSGALSRTWYDDFAY VFGAQLGVTNEAAKDVKIDYKDMPGYIAPVDIYKTSRSMGEKKDINLSYNLTWVFNQVDP KFMYLVRLHFCDFYLSKTNQIVFTVYINNQTAEAEADVIGWTGGKGVPTYRDYVVALKDG SDGNLWLALHPATKSRPEFYDALINGVEIFKLEQGKTLAGPNPNPSEMLAKDQERERSFE NQQQQGGSGTNKAHVIGGAAGGAAAFGIVAALCIAVYQRKKKALGTETHTSSWLPLYGNS HTSGTKSTISGKSTASSHLTTAAQGRCRQSNNNNNTNSNETTGDSSAIFSQIVNPKGR


| Top |