Cherry SNP DataBase

Gene information

Gene Pav_sc0000396.1_g520.1.mk
Chromosome name PAV_r1.0chr6
start 23541108
end 23551861
PAV_r1.0 name Pav_sc0000396.1
start 246517
end 257270
direction -
Annotation NR PREDICTED: cell division cycle 5-like protein
Sequence CDS ATGGCTTTGGCAATTTCTCATGCTTTTCACTGCCCCAAATTGCAGTTTTCCCAGAGGAAT TTCCGCCCTAAAGTCCCAGAGTTAAGGTTCCAGCCTTCTTTCTTCAGAACAATTCCACAG AATACAAGGATAATTTGTGCGGCTGCGTCTGCAGCTGGAAGTTCTAATCCAGACAGTGAT TTAAACCCATATGAGGTTCTCGGTGTGAGCCCCATTGCGGGGTTTGACATGATCAAGGCA GCATATACAAAAAAACACAAGGAGGCTGTAAGGAGCGGTGATGAAGCAACTGCTGCCAGA CTGGAGAAAGCATATGACAAAGTCATGATGGCACAGCTAAGTAATAGGAAGAAAGGTGTG ACGTTTGGTTCCTTCAAGGTCTCAAAGGACATAAAATATGCTGATAAGCAACCAATTGTA CCATGGGGGCCTAGGTTCACCAAGTCTACTGTACAAGATATGCGCATCAACCTGGCAATA TCTGCTGTATTTATTGCTTGGCTTCTTATCAAGCGGAATGCTGAATATAAACCCCTGCAG TTTTTAACTTTTGCATTTGTTTATCGGATCTTTGAGAAGTTGAAATCCTTTGAACCACCT GTATCTCCAACATATACAGAAGACGGTGAGGATGCAGGGAGAGGACTGCAAATGGGAAAA CGGCTGCTTCGTTCTCTTGCCCTAGTGTTTGGCTGTATTGCTGTTGCTTCTCTGGGATAC ACCGGTCTTCTGAATTTGATTGAGTTTACGGGTAGCTTTATTCCTGCTGCTCTTTACAAT AACCAGGTCAAGATGAGGATTATGATCAAAGGAGGTGTGTGGAAGAACACCGAGGATGAG ATCCTCAAGGCGGCGGTCATGAAATACGGGAAGAACCAGTGGGCTCGAATCTCGTCGCTC TTGGTTCGCAAATCGGCTAAGCAGTGTAAGGCTCGCTGGTATGAATGGCTCGACCCCTCC ATCAAAAAGACTGAGTGGACTAGAGAAGAGGATGAGAAGCTTCTTCATCTTGCTAAGCTC ATGCCTACACAATGGAGAACCATTGCCCCAATTGTTGGTCGTACACCATCCCAATGTCTG GAGCGGTATGAGAAACTGCTTGATGCAGCCTGCGTTAAGGACGACAACTATGAACCAGGT GATGATCCACGGAAATTGCGCCCTGGAGAGATTGACCCCAATCCTGAGTCAAAGCCTGCT CGCCCAGATCCTGTTGATATGGATGAGGATGAGAAGGAGATGCTTTCCGAGGCACGAGCT CGATTAGCAAACACTAGGGGAAAGAAGGCCAAAAGGAAAGCCAGGGAGAAACAGCTTGAA GAGGCCAGAAGGCTTGCTTCACTACAGAAAAGAAGAGAATTAAAAGCTGCTGGAATTGAT ACTAGGCAGCGAAAGAGGAAAAGGAAGGGAATAGACTACAATGCCGAAATTCCCTTTGAG AAGAAGCCTCCTCCAGGCTTTTATGATGTTGCTGATGAAGATAGACCTGTGGAACAGCCT CAGTTCCCTACGACCATTGAGGAACTTGAAGGGAAACGAAGGATTGATGTGGAAGCGCAG TTAAGAAAGCAAGATATTGCAAAGAACAAAATTGCTCAAAGGCAGGATGCTCCCTCAGCT ATTCTACAAGCCAACAAGTTGAATGATCCAGAAACAGTTAGGAAGAGATCAAAACTGATG CTTCCTGCACCCCAAATTTCAGACCATGAGCTGGAGGAAATTGCAAAGATGGGTTATGCG AGTGATCTTGCAGGGAGTGAAGAACTCACAGAAGGGAGTGGTGCAACTCGAGCTCTTCTT GCAAACTATTCCCAGACACCAAGGTTGGGAATGACACCTCAAAGAACACCTCAAAGAACA CCTTCTGGAAAGGGTGACACTATCATGATGGAAGCAGAAAATTTGGCCAGGTTGAGAGAG TCTCAAACACCGTTATTAGGAGGAGATAATCCAGAGTTGCACCCATCAGATTTTTCTGGG GTCACTCCTAGAAAAAAAGAAATTCAAACACCAAATCTGATGCTGACTCCTTCTGCAACT CCTGGAGGTGCGGGTCTTACACCTAGAATTGGCATGACTCCAACAAGGGATTCTTTTGGC ATGACTCCAAAGGGGACTCCCATTAGGGATGAGCTCCGTATCAATGAAGAAATTGATATA CATGATAGTGCAAAATTGGAGCAACGAAGAAACTTGCAATTTGGTTTAGGCAATTTACCA CAGCCCAAGAATGAGTACCAGATAGTCATGCAACCAGTTCCAGAAGATAATGAAGAACCC GAGGAGAAAATTGAAGAAGACATGTCTGATAGGCTAGCTAGAGAAAGAGCTGAGGAAGAA GCACGCCAGCAGGCGTTACTTAGGAAGAGATCAAAAGTATTGCAGAGGGAGCTCCCCAGA CCACCAGCTGCCTCATTGGAATTTATTAGAAATTCCTTGACAAGAGCAGATGGAGATAAG AGTTCCTTTGTTCCTCCTACTTCAGTTGAGCAGGCTGATGAAATGGTTAAAAAGGAACTT CTTAGTGTACTGGAGCATGATAATGCCAAGTATCCACTTACTGAGAAAGTAGACAAACGG AAAAAGAAAGGTGCCAAGCGCAGTGCTGGTGGACCTAGTGCTTCTGTCCCTGTGATAGAA GATTTTGAAGAAGATGAAATGACAGAGAATGAATTTGAGAATGTGAAGAAGAAGATGGAG GATGATATCCAGAAGGCAGCAAGCATTGAGAGCAAAGTTAAAGTTCGCACATATGGTTAT GAGATGCGAGCTAAAGATGGTCTTTGGCCAAAAATTGAGGAGACTTTTAAGCAGATGGAC ACTGCTGCAAAAGAACTTGAATGCTTCAAAGCTTTACAGAAGCAAGAAAAATTAGCGGCA TCACACCGGATAAATAATATCTGGGAGGAAGTTCAGAAACAAAAGGAGCTCGAGCGAAAT TTACAAAAGCGGTATGGGGATCTTGTAGTGGAGTTGGAAAGGGTACAGCACCGTATGGAT GAATACAGAGCACAAGCAGAAAAACAAGAAGAAATTGCAGCCATGAATTGTGATCAAGAG TTGGCTGAGGCCACAGAAAATGTGACTGTTCTGCAGGCAACTGAGAATCCTGATCCTATA ACTGCTTCAGATGAGCTTAGGAGCACTGTTCCTGGTGGTGCATCTAATGGTGAAGCTACA AATCTGCAAATGGATGGTGATAAGGACATTGATGCTGGAAAAGTTCACGAGACAGTGTCC AGGGATGTTAATTTACCTGATAACATGCCTTCTGCTGTGGAAGGAGAGAATGATCCAAAT TCTCAGCTCACTAACTCAGGTGTAATATACTCCAGTGGGGTTGCAGCTCAAGACTCTGTT AGCATAGGAGATAATGTTTCTGACTCCAGTGGGGTTGCAGCTCAAGACTCTGTTAGCATA GGAGATAATGTTTCTGACAATCTGGTTGCAACTGAAAACAAAATGGTAAATGATCCTGAT GATGGGGTAATTAGTGACAATATGACGAGGAGTGTTGTAGCCGAGGATCAAAAAGTTGAG ATGCGGCAGAACTTGACTGAACTTGAAGGCAGTGTTCAAGCAGCAGGGGATGGTGGTTTT GCTAATGGGAGTACCACCATTGTTTCTGTCGAAGGAGAGGTAGAGAATTCAGCTGAAAAC GCAGCAACCCAAATCTAA
PEP MALAISHAFHCPKLQFSQRNFRPKVPELRFQPSFFRTIPQNTRIICAAASAAGSSNPDSD LNPYEVLGVSPIAGFDMIKAAYTKKHKEAVRSGDEATAARLEKAYDKVMMAQLSNRKKGV TFGSFKVSKDIKYADKQPIVPWGPRFTKSTVQDMRINLAISAVFIAWLLIKRNAEYKPLQ FLTFAFVYRIFEKLKSFEPPVSPTYTEDGEDAGRGLQMGKRLLRSLALVFGCIAVASLGY TGLLNLIEFTGSFIPAALYNNQVKMRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSL LVRKSAKQCKARWYEWLDPSIKKTEWTREEDEKLLHLAKLMPTQWRTIAPIVGRTPSQCL ERYEKLLDAACVKDDNYEPGDDPRKLRPGEIDPNPESKPARPDPVDMDEDEKEMLSEARA RLANTRGKKAKRKAREKQLEEARRLASLQKRRELKAAGIDTRQRKRKRKGIDYNAEIPFE KKPPPGFYDVADEDRPVEQPQFPTTIEELEGKRRIDVEAQLRKQDIAKNKIAQRQDAPSA ILQANKLNDPETVRKRSKLMLPAPQISDHELEEIAKMGYASDLAGSEELTEGSGATRALL ANYSQTPRLGMTPQRTPQRTPSGKGDTIMMEAENLARLRESQTPLLGGDNPELHPSDFSG VTPRKKEIQTPNLMLTPSATPGGAGLTPRIGMTPTRDSFGMTPKGTPIRDELRINEEIDI HDSAKLEQRRNLQFGLGNLPQPKNEYQIVMQPVPEDNEEPEEKIEEDMSDRLARERAEEE ARQQALLRKRSKVLQRELPRPPAASLEFIRNSLTRADGDKSSFVPPTSVEQADEMVKKEL LSVLEHDNAKYPLTEKVDKRKKKGAKRSAGGPSASVPVIEDFEEDEMTENEFENVKKKME DDIQKAASIESKVKVRTYGYEMRAKDGLWPKIEETFKQMDTAAKELECFKALQKQEKLAA SHRINNIWEEVQKQKELERNLQKRYGDLVVELERVQHRMDEYRAQAEKQEEIAAMNCDQE LAEATENVTVLQATENPDPITASDELRSTVPGGASNGEATNLQMDGDKDIDAGKVHETVS RDVNLPDNMPSAVEGENDPNSQLTNSGVIYSSGVAAQDSVSIGDNVSDSSGVAAQDSVSI GDNVSDNLVATENKMVNDPDDGVISDNMTRSVVAEDQKVEMRQNLTELEGSVQAAGDGGF ANGSTTIVSVEGEVENSAENAATQI


| Top |