Cherry SNP DataBase

Gene information

Gene Pav_sc0000398.1_g200.1.mk
Chromosome name PAV_r1.0chr4
start 15222091
end 15223226
PAV_r1.0 name Pav_sc0000398.1
start 89102
end 90237
direction +
Annotation NR PREDICTED: psbQ-like protein 2, chloroplastic
Sequence CDS ATGGCTCATTTGGCAAACTTAAATGGAGTATCTGAAACACTGCCAGCCATACCAAGGCTT CCAGGCATACAAAGGACCCAAAAGAGAGTGAGCATTGTTGGCTTTATAGGCAAGAAAAGA GATGATCTTCAGGAACAGCCACTACAAACTACAAGAAGACTAGCATTAGGCCTTGCCTCT ATTGCACTTGTTGGGAACTCCTGCAATGGAGTCTCTCTTGCTGAGGGCAACGGGTTCTGG ATCGACGGCCCTCTGCCCGTGCCTTCTGCTGAAAATAAAATTGCAAATGAGAAGACGGGG ACTCGTTCTTTTCTGAAAAAGGGACTCTACATGGCAAACATTGGAACCAAAGGGAGGAAG TTTAGGCTTAAGAAGTATGCATTTGATCTCCTGGCAATGGCAGATTTGATTGCACAAGAT ACCCTAAACTATGTTAGACGGTTCCTGCGGCTAAAATCCACATTCATGTACTTTGATTTC GACCAAGTTATCTCTGCAGCACCAGTCGATGAGAAACAACCTCTCACTGATCTTGCTAAT AGATTGTTCGACACCGTAGAAAAGCTTGATGGCGCTGTGAAGCAACGCAACCTATCTGAG ACTGAATCGTATTATAAAGACACAACAGTTATTCTCCAGGAGGTCATGGATCGAATGGCA TGA
PEP MAHLANLNGVSETLPAIPRLPGIQRTQKRVSIVGFIGKKRDDLQEQPLQTTRRLALGLAS IALVGNSCNGVSLAEGNGFWIDGPLPVPSAENKIANEKTGTRSFLKKGLYMANIGTKGRK FRLKKYAFDLLAMADLIAQDTLNYVRRFLRLKSTFMYFDFDQVISAAPVDEKQPLTDLAN RLFDTVEKLDGAVKQRNLSETESYYKDTTVILQEVMDRMA


| Top |