Cherry SNP DataBase

Gene information

Gene Pav_sc0000410.1_g280.1.mk
Chromosome name PAV_r1.0chr1
start 26754720
end 26763609
PAV_r1.0 name Pav_sc0000410.1
start 169834
end 178723
direction -
Annotation NR PREDICTED: BTB/POZ domain-containing protein At3g19850-like
Sequence CDS ATGTCTATCCCGACGAATGGGTTCGCAGATGAAGACAGCGGAATCGCACAATTAGGTTTA GGGCTTGCACATTTGAGAGGCTCGAGGCTTGCGACCGCCGTTAGGTTGAAAGGAAACTCA GGAAAAGGAGCTCCTTCAAATGGGTCTGTCTATGTTTGCAACTTGCCTGAGGGGACTGAT GAAAATATGTTGGCTGAATATTTTGGCACCATTGGGTTGTTAAAGAAAGACAAGCGAACA GGTCGACCAAAAATTTGGCTATACCGAGACAAACTGACAAACGAACCTAAGGGAGATGCT ACTGTAACATATGAGGATCCACATGCTGCATCAGCAGCCGTTGAATGGTTTAACGACAAG GATTTCCATGGTAATGCCATTGGGGTTTTTATAGCAGAGTCAAAAAGCAAAGATGATCAG ACTCATAATCCTGGGGGCGATCCAATTGTTGGCGGTGAGTATGATGGACTTGAGGAAATT GCTCAGGATACAAATGGAGGTGTTGGCGGCGGTAGAGGTCGGGGTGATGCTCCTGGGAAA GCATGGCAACAAGAGGGAGACTGGACATGTCCGAATACAAGGTGTGGCAACATCAACTGG GCAAAGCGTACAAAATGCAACATATGCAACACAAATAGACCTGGTCACAATGAAGGTGGT GTAAGAGGGGGACGTGGTGGGGGTTACAAAGAACTTGATGAAGAAGAACTAGAGGAAATC AAGCGACGTCGGCGGGAGGCAGAAGAAGATGATGGCGAGATGTATGATGAGTTTGGCAAC CTTAAAAAAAAATTTCGCGCTAAAACACAACAAACTGAAACTGGACGAGCTCTTCCAGGT GCTGGACGTGCTGGATGGGAGGTGGAGGAAATAGAGATGGCAGGGAGAGAAATAGAGAGA GAGGAAGGGAACGTGATGATAGACCGAGCAGCAAGAACAGAGAAAGAGATGACAGGGATA GGCGTCGCAGTAGAAGCAGAGAAAGGGAAAGGGATAGGGGGAGAGATAGACCTCGAGATT ATGATTATGATCGGGACAAAGAATATGGGCGGGACAGGGACAGAGACCGGGATCGGGACC GGAACAGGCACCGTTACTGAAGGTTATGGGATAGAGTTTTGGTTCTCTTATGCAAGTAGG TCGGACTGCATTCGTGTTGAACTATGTTTTACTTGGCATTTTAAGCTATTCGGATGGAAT ATGGGTCTCCACCACTTTCTTCAAACTGTGATCTGCGCCTGCATCAGCACATTAGCTTTC AGCATTCTCTCGCCGTCTGTGACGCAGATAGAGGAGATTTTATCGACATATTCAGGAAGG TTGAAGAAGATCATCAAGCATGAAAGGAGAAGGACCCAGATCAAGAATTCAGGGATTGAA ATCGATGACTTCCCTGGAGGCCCTGATGGGTTCGAGTTGATTTCTCGATTCTGTTACAAC AATGGAAGAATCACAACCACAGTTTCAAATGTGTCCCTCCTCCACTGCTGTGCAGTCTAC CTTGGTATGACTGAGAAGCTCTCAACTTGCAATCTATTGCAGCAAACACAAGTCTTTCTT GATGGACTTTTTGAGTGGTCATGGAAAGACATACTAGTCTGCCTCAAGAGCTGCGGCTCA TTCTGCAACTATGCAGATTCATCTGGTCTGCTAGACAAACTCATTTGTGCTCTGTTGGCT AAGATTGCTCAAAATTCAGATATAAGCAGCCTCATTGCCGGGTCGTCTTCTACGTCCTCT TCTCCAGAAACTGCATCTGGGTTTAGACCCTCTTCCTCATATAAGAACACCCCTGAATCA ATCAAGCCAAGCTCATCAAGCAGAGCCTGGTGGTTTGATGATGTGGCCATTTTACCACCA AAGATCATTGAAAAACTCTTCCAGAGTTTGGGTGCTTATGGAGCTGATAACAACAGCTTG ATCCTCACAAGATTTCTCCTTCATTACCTGAAAGTTTCAGCTCAGAGGAAAGCTAATTAT AATCATACATCATCAGCGGCAGTGAATTCAAAATGTGAGTTTGGTGGTCTTGCGGACACA GCTGTTCATGGGGTCATTTTGGTTGGGAGAAAAACGTTTTCCTGCAGAGCGCTGTTTTGG GTATTGAGGATTGTGTCTGGCTTTGGACTGAGTAAAGAGTACAGGCTTGGTTTGGAAGGA TTGATTGGTGGAATGCTTGATGAAGCAACATTGGATGACTTGCTAGTGTCTGGGCATGAC AGGGGTGTTTTTGATGTCAATCTTGTGAAAAGATTGATAAGAGTGTTTGTTAAAAGTTAT GGAGTGTCAGTGCAGAAGTTGAAGATAGCCGGGAGATTGATTGATAAGTACTTGGGTGAA ATATCCCCTGATCAGAATCTCAAGATTTCTAAATTTTTGGGAGTTGCAGAGAGTTTACCT GATTCTGCCAGGGATTGCTTTGATGGGGCCTACAGAGCGATTGATATCTATCTTGAGTCT CATCCTAGTCTTTCATTTGAGGAGCGGTCAAGATTATGCAGATGCCTAAACTATGAAAAG CTGAGCCTTGGAGCATGTAAAGAGCTTGCCAAGAATCCAAAAATCCCACCAAGGGTTGCC ATGCAAGCCCTTATGTCTCAACAATCCAAAATAACACCACCAACACCAAAACCAAAACAA CAATGTGTAAATTATGAAATGTTTGCGTACAAGGGTGGTGTTGATGATGAAGAGAGCTTA GCAGAAGAAGGGAGGATGGAAGAAACACTAAACTTGCAGAGGATGCAATGGAGGGTGGTG GAGTTAGAGAAACTGTGCAGGCAAATGAAGGGGCAGATGTCAAGGATGGTGAAGCATAGT CATGTTTTCGCTACCCCAACTCATACTAGACCTCTGCCTAGACTTTGTTGA
PEP MSIPTNGFADEDSGIAQLGLGLAHLRGSRLATAVRLKGNSGKGAPSNGSVYVCNLPEGTD ENMLAEYFGTIGLLKKDKRTGRPKIWLYRDKLTNEPKGDATVTYEDPHAASAAVEWFNDK DFHGNAIGVFIAESKSKDDQTHNPGGDPIVGGEYDGLEEIAQDTNGGVGGGRGRGDAPGK AWQQEGDWTCPNTRCGNINWAKRTKCNICNTNRPGHNEGGVRGGRGGGYKELDEEELEEI KRRRREAEEDDGEMYDEFGNLKKKFRAKTQQTETGRALPGAGRAGWEVEEIEMAGREIER EEGNVMIDRAARTEKEMTGIGVAVEAEKGKGIGGEIDLEIMIMIGTKNMGGTGTETGIGT GTGTVTEGYGIEFWFSYASRSDCIRVELCFTWHFKLFGWNMGLHHFLQTVICACISTLAF SILSPSVTQIEEILSTYSGRLKKIIKHERRRTQIKNSGIEIDDFPGGPDGFELISRFCYN NGRITTTVSNVSLLHCCAVYLGMTEKLSTCNLLQQTQVFLDGLFEWSWKDILVCLKSCGS FCNYADSSGLLDKLICALLAKIAQNSDISSLIAGSSSTSSSPETASGFRPSSSYKNTPES IKPSSSSRAWWFDDVAILPPKIIEKLFQSLGAYGADNNSLILTRFLLHYLKVSAQRKANY NHTSSAAVNSKCEFGGLADTAVHGVILVGRKTFSCRALFWVLRIVSGFGLSKEYRLGLEG LIGGMLDEATLDDLLVSGHDRGVFDVNLVKRLIRVFVKSYGVSVQKLKIAGRLIDKYLGE ISPDQNLKISKFLGVAESLPDSARDCFDGAYRAIDIYLESHPSLSFEERSRLCRCLNYEK LSLGACKELAKNPKIPPRVAMQALMSQQSKITPPTPKPKQQCVNYEMFAYKGGVDDEESL AEEGRMEETLNLQRMQWRVVELEKLCRQMKGQMSRMVKHSHVFATPTHTRPLPRLC


| Top |