Cherry SNP DataBase

Gene information

Gene Pav_sc0000410.1_g390.1.mk
Chromosome name PAV_r1.0chr1
start 26826463
end 26837220
PAV_r1.0 name Pav_sc0000410.1
start 241577
end 252334
direction +
Annotation NR PREDICTED: alanine--tRNA ligase
Sequence CDS ATGAGGAGTGGATTCTGTGAGAGAGGAACAATAGTCTTCCGCTCCCTTCTACTCACACAA CCTTACCCTCGCTCTCCTCCTACTCCCGCTTGTCTGGCGCCGTCACTTCTCTCAATCTCT ATCTCTTCCAATCGCTCCCTCACCACCTCCTACAAGTGCCTCCTTCTCAAACTAGCCTCC TATTCTTCATTGTCTGTAACGTCGTCGTTTCGTACCACCATGACGGGCGTCGAATCCCAG GGAGTGGAGTGGCCGGCTAAGCGTGTCAGGGACACGTTTATGAGGTTTTTCGAGGAGAAG AGCCACGTTTACTGGAAGTCTAGCCCTGTTGTGCCTCACAACGATCCCACTCTTCTATTC GCTAATGCTGGTATGAACCAGTTCAAGCCCATCTTTTTGGGCACAGCTGACCCAAACACT CAGTTAAGCAAGCTGACTCGAGCTTGCAACACGCAGAAATGTATAAGAGCAGGTGGGAAA CACAACGATCTCGATGATGTAGGAAAAGACACTTACCACCATACCTTCTTTGAGATGCTC GGAAATTGGTCTTTTGGGGATTATTTCAAGAAAGAAGCCATTGGGTGGGCTTGGGAGCTT CTCACCCAGGCAAGCAGATTTGACCAAATGCATAGTTTCATCACCGGTTACTATATCAAG GCTGATAATATTAGTGCGACCATTGCCTTTTTGATATGCAGGTTTATAAGCTGCCAGAAG ATCGAATTTATGCCACCTATTTTGGTGGTGATGAGAAGGCTGGTCTTGCTCCTGATAATG AAGCTAGAGATATATGGCTTAAGTTTTTACCACCTGCTCGGGTACTACCTTTTGGGTGTA AGACCCTATGATGATGATCCAAAAGGTGATAATTTCTGGGAGATGGGTGATACTGGTCCT TGTGGTCCTTGCACTGAAATTCATTATGATAGAATAGGTAATCGTGATGCTGCATCCTTA GTCAACAATGACGATCCTACCTGCATTGAAATATGGAATCTCGTCTTTATTCAGTTCAAT AGGGAAAGTGATGGCTCTCTAAAACCGCTGCCTGCTAAGCATGTTGACACTGGGATGGGA TTCGAAAGATTAACTTCTATACTTCAGAACAAGATGAGCAATTATGATACTGATGTGTTC ATGCCCATCTTTGATGCTATCCAACAGGCAACAGGGGCTCGGTCATATTCAGGGAAAGTT GGGCTGGATGATGTAGACAAAGTTGACATGGCATACAGAGTTGTTGCAGATCATATAAGA ACTCTTTCATTTGCCATTGCTGATGGGTCTCGTCCAGGCAATGATGGTCGTGAATATGTT CTAAGGCGTATTCTTCGTCGGGCTGTTCGGTATGGAAATGATGTCTTAAAAGCTAAAGAA GGATTCTTTAATGGGCTTGTAGGCATCCTGGTGACAGTGATGGGTGATGTTTTTCCAGAG CTGAAACAGTATGAAGCACATATTAGGGAGATAATCAAAGAGGAGGAAGAAACTTTTGAG AAGACTTTACAGAAGGGAATAGAAAGATTTAAGAAGGCTGCTCAGGATGTTCAAGGGAAA ACATTTAGTGGGCAGGATGCTTTTGTCTTGTGGGACACGTATGGGTTTCCATTAGATTTG ACACAGTTGATGGCAGAGGAAAGGGGGTTACTAGTTGATGTTGAGGGTTTCAATAATGCT ATGGACGAGGCTCGGGAAAGATCAAGGAATGCTCAAAATAAGCAAGCTGGTGGTGCTATT GTTATGGATGCCGATGCTACTGCTGCATTGCACAAGAAGGGGGTTGCTGCAACAGATGAC AGCTTTAAATTTATCTGGTGCCAGGACCATGAAAGTGTGATAAAAGCAATTTACACCGGT TCTGAGTTTATTAATAGTGCTTCTGCTGGCAATGAAGTTGGTATAGTTTTGGGATCAACA AGTTTCTATGCTGAGCAAGGTGGTCAGGAAGTTCTTGGCAGTCATGTTGACCAGAAGGGT TCTATTGTTCTTCCTGAAAAATTAAGATTTGATTTTTCTCATGGCAAGCCGGTAGAACCT GACAATTTGAGAAGAATAGAGTTCATTGTGAATGAGCAAATTAGAGCAGAATTGGATGTT TTTGCTAAGGAGGTAACCCTGATTGAAGCCAAGCGTATCAATGGTTTAAGGGCTGTATTT GGAGAGGTATATCCTGACCCAGTAAGAGTGGTGGCTGTTGGGCGAAAAGTTGAGGACCTC CTGGCTGACCCCGAAAATAAGGAATGGTCATCAATTTCAGCAGAACTTTGTGGAGGGACT CATATATCAAATACGAGGGAAGCCAAGGCCTTTGCTCTTTTATCCGAGGAGGGAATTGCC AAGGGAATACGTAGGATAACTGCTGTCACAACTGATGGTGCTTTTAAGGCAATTGAATTG GCACACTCGCTTGAGCAGGAAGTAGATGAAGCATCCAAGGCTGAAGGAAGCTTGCTGGAG AAGAAAGTAGCTTCCTTAAAGTCTCGGGTGGACTCGGCACCAATTCCAGTGGCTAACAAA GCTGAAATAAGGGCCAAAATTGCTGTACTTCAGAACCAAGTGAGGAAGGCACAAAAGATT ATTGCTGAGCAAAATATGCAAAATGCTGTCAAGGTTGCAACTGAGATGGCCGAAGTTGCT GCTTCAGATGGGAAAGCTTACTGTGTATCCCATGTTGATGTTGGTTTGGATGTGGCTGCA GTTCGCGAGGCAGTTGTGAAAGTCATAGAGAAGAAGGGAATGCCTGCCATGGTTTTCAGC ACAGATGAAACCACAAATAAGGCTGTGGTTTGTGCTGGCGTACCAGGAGACAAAGGCAAC CAGTTGGAGGTCTCAGAGTGGTTGACCGCATCTCTGGGTCCCCTGAAAGGAAGGTGTGGT AAAGGAAAAGGTGGCCTTGCGACTGGCCAGGGAACAGATGCATCTCGTCTAAATGAAGCA GTAGACCTTGCAACTTCATTTGCGCAGATGAAATTGAGATGA
PEP MRSGFCERGTIVFRSLLLTQPYPRSPPTPACLAPSLLSISISSNRSLTTSYKCLLLKLAS YSSLSVTSSFRTTMTGVESQGVEWPAKRVRDTFMRFFEEKSHVYWKSSPVVPHNDPTLLF ANAGMNQFKPIFLGTADPNTQLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEML GNWSFGDYFKKEAIGWAWELLTQASRFDQMHSFITGYYIKADNISATIAFLICRFISCQK IEFMPPILVVMRRLVLLLIMKLEIYGLSFYHLLGYYLLGVRPYDDDPKGDNFWEMGDTGP CGPCTEIHYDRIGNRDAASLVNNDDPTCIEIWNLVFIQFNRESDGSLKPLPAKHVDTGMG FERLTSILQNKMSNYDTDVFMPIFDAIQQATGARSYSGKVGLDDVDKVDMAYRVVADHIR TLSFAIADGSRPGNDGREYVLRRILRRAVRYGNDVLKAKEGFFNGLVGILVTVMGDVFPE LKQYEAHIREIIKEEEETFEKTLQKGIERFKKAAQDVQGKTFSGQDAFVLWDTYGFPLDL TQLMAEERGLLVDVEGFNNAMDEARERSRNAQNKQAGGAIVMDADATAALHKKGVAATDD SFKFIWCQDHESVIKAIYTGSEFINSASAGNEVGIVLGSTSFYAEQGGQEVLGSHVDQKG SIVLPEKLRFDFSHGKPVEPDNLRRIEFIVNEQIRAELDVFAKEVTLIEAKRINGLRAVF GEVYPDPVRVVAVGRKVEDLLADPENKEWSSISAELCGGTHISNTREAKAFALLSEEGIA KGIRRITAVTTDGAFKAIELAHSLEQEVDEASKAEGSLLEKKVASLKSRVDSAPIPVANK AEIRAKIAVLQNQVRKAQKIIAEQNMQNAVKVATEMAEVAASDGKAYCVSHVDVGLDVAA VREAVVKVIEKKGMPAMVFSTDETTNKAVVCAGVPGDKGNQLEVSEWLTASLGPLKGRCG KGKGGLATGQGTDASRLNEAVDLATSFAQMKLR


| Top |