Cherry SNP DataBase

Gene information

Gene Pav_sc0000410.1_g720.1.mk
Chromosome name PAV_r1.0chr1
start 27082709
end 27088474
PAV_r1.0 name Pav_sc0000410.1
start 497823
end 503588
direction +
Annotation NR PREDICTED: transmembrane protein 53
Sequence CDS ATGGCTTCCTTGTCTGGGATCGTTCAACGACCTTTGGTTGCGGCTGCTGCTCTTGCTGTA GCTTCAGTTTCTACTGACATCTCTGATAAATTGCCATCTCACAGATCCACTGACGATTGT TCTACCTCGGATTTATCACATTCTTCATTGCATAACACCTTTCAAGATTCAAAGCTATCC TGGGTTTCACACATTTCGGTTTCTAAGCTTGCAAACTTGTCCTTTATATCTAGAATTCGA GTACCTGTGCCCAATATTAACTTCCCAACTCCCAATTCAGGCGGCAAATTTGTTCCCAAG TTGCTATATTCTTCGGTTGCATCTTCACCTGTTCTTCTTAATTTGTATCAGTCTGCAGAC TTGGTTAAAACAACAAACCCAACTACATATAAGCATGATATATCCACTTCCCCCTCTGAA GTCACGTACAGATGGCATTTACCTGAGCCAAATGCCATAGATGTTTCCGGTACTTCTGGT TGCTCCTCGGCAAAGTTCAGGACTGTGGTGGTTTTACTAGGATGGTTGGGAGCAAAGCAA AAACATCTCAAGAAGTATGCTGAGTGGTATACCTCAAGGGGTTTTCATGTAATTACCTTT ACTTTGCCGATGTCTGAGATTCTCAAATACCAACCTGGTGGGAAAGTTGAAGAGCACATC AACTCCCTTGTGAGACATTTGGCTGATTGGTTAGAGGAGGAGCATGGAAAGAATCTGGTT TTTCATACTTTTAGCAATACTGGATGGTTAACGTATGGGGTAATGTTGGAGCAGTTCCAG AAGCACGATCCTTCTCTAATGGGCAGGATTCGGGGTTGCGTTGTGGATTCTGCACCTGTT GCAGCACCTGACCCACAGGTTTGGGCTTCTGGTTTCTCAGCAGCCTTTCTGAAAAAGCAT AGTGTAGCAGCAAAAGGAACCGTAGACTCAAATGAGTCAGGGATGGATGCTTTGGTTGGC ACCAAGGGAGTAGTGGCACCCAAACCTGCAGTAACTGAAGCAGCTTTGCTAGTAGTTTTG GAGAAGTTCTTTGAAGTGATTTTGAATCTTCCTACAGTGAACAGGAGGCTTTCTGATGTC GTGGGGTTATTGTCAGCCCGACAACCAAGCTGTCCGCAATTATATATATACAGCTCTGCA GACAGGGTGATTCCTGCAGGGTCGGTGGAATCATTCATAAAACAGCAACGGAGGGCTGGA CATGAGGTTAGGGCTTGCAACTTTGTGTCCACACCTCATGTTGATCATTTCAGAAACGAC CCGAAACTGTACACTTCTGAGCTAACCCAATTTCTGGAGGACTGTGTGCTTACTTGTTGC AAAAAGTCTCATTTATCTTAA
PEP MASLSGIVQRPLVAAAALAVASVSTDISDKLPSHRSTDDCSTSDLSHSSLHNTFQDSKLS WVSHISVSKLANLSFISRIRVPVPNINFPTPNSGGKFVPKLLYSSVASSPVLLNLYQSAD LVKTTNPTTYKHDISTSPSEVTYRWHLPEPNAIDVSGTSGCSSAKFRTVVVLLGWLGAKQ KHLKKYAEWYTSRGFHVITFTLPMSEILKYQPGGKVEEHINSLVRHLADWLEEEHGKNLV FHTFSNTGWLTYGVMLEQFQKHDPSLMGRIRGCVVDSAPVAAPDPQVWASGFSAAFLKKH SVAAKGTVDSNESGMDALVGTKGVVAPKPAVTEAALLVVLEKFFEVILNLPTVNRRLSDV VGLLSARQPSCPQLYIYSSADRVIPAGSVESFIKQQRRAGHEVRACNFVSTPHVDHFRND PKLYTSELTQFLEDCVLTCCKKSHLS


| Top |