Cherry SNP DataBase

Gene information

Gene Pav_sc0000410.1_g810.1.mk
Chromosome name PAV_r1.0chr1
start 27153867
end 27155834
PAV_r1.0 name Pav_sc0000410.1
start 568981
end 570948
direction +
Annotation NR PREDICTED: high mobility group B protein 7-like
Sequence CDS ATGGGAGGTGGGTCAATGAAATCGAACCCAACCAAGGCGAGGAAGAGGGTGGAGGCCACT GAGGAGTCAAGTGTACCTTCTCTTGTTCGTGGCAAGGACGGCAGTGCCTTTGCCCGATGC GAGGAGTGCAACAAGAATGTCCCAGTGGCACTCATCAGCATGCACAGCTGTAGCCTTGAC GCCAAAATCAAGTTGCATCTGAGCTCTCAAGTTGTGGAAAGGCCGCCTGAAGCGAATAAG AAGTCTCCCACAGAGAGGAAGAGGTCCACTACATCAGAACCCAAGTCAAAGAGAGCTAAG AAGGACAAAGATCCAAATGCACCAAAGCGCCCTCTCACTGCCTTCTTCCTCTTCATGGAC GATTTCAGGAAATCCTTTAAGGAAGCTAATCCTGATTCGAAGCTTGTTAAGACGGTTGCA AAGGAGGGTGGCGAGAAGTGGAAGTCTATGACTGACGAGGAGAAGAAGCCTTATGTGGAT AAGGCAGCTGAGCTTAAAGCAGAGTATAAAAAAGCCTTGGAGATGGAGACTGATGATGCT GATGCCGATGCCGATGTAGATGCAGAAGTTGGGGATGATGAAATTGAAGGAGGTTCAGAG AAAGAAGCTTCAGAGAAGGAAGTTTAA
PEP MGGGSMKSNPTKARKRVEATEESSVPSLVRGKDGSAFARCEECNKNVPVALISMHSCSLD AKIKLHLSSQVVERPPEANKKSPTERKRSTTSEPKSKRAKKDKDPNAPKRPLTAFFLFMD DFRKSFKEANPDSKLVKTVAKEGGEKWKSMTDEEKKPYVDKAAELKAEYKKALEMETDDA DADADVDAEVGDDEIEGGSEKEASEKEV


| Top |