Cherry SNP DataBase

Gene information

Gene Pav_sc0000412.1_g040.1.mk
Chromosome name PAV_r1.0chr8
start 15493900
end 15494283
PAV_r1.0 name Pav_sc0000412.1
start 16003
end 16386
direction -
Annotation NR hypothetical protein PRUPE_ppb014005mg, partial
Sequence CDS ATGGAAGCTCTGCCCGACTTTGGTTCATTGCCTGTTTTACCCCACAGTCCTATAGTTATG ACCATCTTTGATGTGTTATCGGAGCGATTGAACGAGTCTCATGTTTGGAAGTTGGATTTG CTGAATGTGTGTCCCATCCAAGAAAAGAGGTTGTATCCGAAGACATGGAAAGAGATGTTT TTATGTCAGCAACAGAAGCCCAAGCTCATGTTTATTACATTAGCTAAAACTTATTTGTTC TTGTTCATTCCTATCACAACAAGATGGACTTTACCTGGTGTGCCTACCTGCATCAAGACT GCAGCCACTGGTGTGCCTGATTCATGGAATGAGCTTCTTTATGCACTATTCCTTAAACCT GAATCTCTCAGCACATCTTCCTGA
PEP MEALPDFGSLPVLPHSPIVMTIFDVLSERLNESHVWKLDLLNVCPIQEKRLYPKTWKEMF LCQQQKPKLMFITLAKTYLFLFIPITTRWTLPGVPTCIKTAATGVPDSWNELLYALFLKP ESLSTSS


| Top |