Cherry SNP DataBase

Gene information

Gene Pav_sc0000415.1_g070.1.mk
Chromosome name PAV_r1.0chr1
start 11121687
end 11124567
PAV_r1.0 name Pav_sc0000415.1
start 43994
end 46874
direction +
Annotation NR PREDICTED: F-box protein At3g07870-like
Sequence CDS ATGACCATTGAAGGCTCGTGCAATGGCTTCCTCTGTCACCAAGAAGTCCATTTTGACTTG AGCCGTCATCTTCACATCTCCAATCCAGTTACTGGCGAGTTTTTATCTCTCCCAGCACCT CCAAATCCTGATACACGTGACTGTTATGGTTTTGGGTTTAGCCCCATCAGTGAGGTCTAC AAGCTACTTCGGGTTTGGTCTCCATACGGAAAGCCTGACCAAGTAATGGTTTTGACTGTT GGCTCTGGCATTTGGAGAAACATTGGGCATCCTGCCTACTCTTTTGATGGTGTAACTCCT CATGGGATTTATCTCAATGGGTTTCTTCATTGGATTGGTCACAGTAGTAGTGATTGTTCC CGTTTGGTATGTGCCTTTGATGTTGAAAGCGAGCAGTTCCAAGAGTTACCACTACCCCCT TGTATTTATGATCTGGATGAAACTTATTTTAATCTCAGAGTATTGAAAGGTTGGCTCTCT GTAATTCTTAACTTGAATGATGATATCATTGTTTGGGTGATGAAGGATTATGGAGTGAAG GAATCTTGGACTAAAGAGCACGAGTTGAAAGACCCAGTAGGTTATTTTGGCACTTTCATG TTGAAAGCTATTACTGAGGAAGGGCAAGTTTTGGGGATACATCAGGGTAGATTGCAGGCT TATACTCCCACAACAACGGGCCTTGTGACGGTTGAGGACTTCAGGGTGTGCATTGCAAAC TGGACCAATCTTGACTGTGAATGA
PEP MTIEGSCNGFLCHQEVHFDLSRHLHISNPVTGEFLSLPAPPNPDTRDCYGFGFSPISEVY KLLRVWSPYGKPDQVMVLTVGSGIWRNIGHPAYSFDGVTPHGIYLNGFLHWIGHSSSDCS RLVCAFDVESEQFQELPLPPCIYDLDETYFNLRVLKGWLSVILNLNDDIIVWVMKDYGVK ESWTKEHELKDPVGYFGTFMLKAITEEGQVLGIHQGRLQAYTPTTTGLVTVEDFRVCIAN WTNLDCE


| Top |