Cherry SNP DataBase

Gene information

Gene Pav_sc0000416.1_g230.1.mk
Chromosome name PAV_r1.0chr6
start 2690056
end 2697949
PAV_r1.0 name Pav_sc0000416.1
start 85771
end 93664
direction +
Annotation NR PREDICTED: enhancer of mRNA-decapping protein 4
Sequence CDS ATGGCTTCTTCTGGGAATCCAAATCCACCGCCCCAGCAGCAACCCCAACCCTTTGACATG CAGAAATTCTTTAAACCAACAAACCCAACGCCACTCTCGCCCCAATCCCAAACCCAGAAC AATTCAAACCAAAACCCTAACCCTAATTTGAGTTCCTCTTCGTTCCCAATCCCACCCGCC TCTTTCCCCCCGCCCTCTGGCCCTTACTCGTACCCTCCCCAGACGGCACCGTTTCACCAC CACCAATTCCAATACCACCCTCACCCTCAGCCCCACCCCCACGGTAACCATCCCCAAATC CCTTACTCTCCTCAAGACCACCACTTGCTCCACCAGAGGTCTCTCTCATTTCCCACGCCA CCCCTCCAACCCCCCTCTACTTACAACATTGCCACGGCCCCTTCCAACCCTAGCAGCAAC AACAGTAGCACCTCCAATTCGAACCCCAATTCTGGTGCTCGAATCATGGCGCTTCTCGGC GCTCCATCTGGCAATCTAGAGTTGTCGGCTGCTCAGCCCGAGTTATCCGTCCCCCCAGGG GTCTCGATCGTGCCCACTATCCCTATGGGGATTCCACCCACTGGCCCCACTCGAATGCCG AGCAATAAGCTCCCTAAAGGCAGGCATTTGATTGGCGATAATGTGGTTTACGATGTGGAT GTTAGGTTACAGGGTGAGTTTCAGCCACAGCTTGAAGTTACGCCGATTACCAAGTATGGT TCGGATCCCCAGCTTGTGCTGGGCCGCCAAATTGCTGTTAATAAGTCGTACATATGCTAT GGATTGAAGCAGGGAAACATTCGGGTTTTGAATATACACACTGCATTGAGATCTTTGTTT CGAGCTCATACACAGAGGGTCACAGACATGGCTTTCTTTGCTGAGGATGTTCACCTTTTG GCTAGTGTGAGTGTAGAAGGACGGCTTTTTGTATGGAAGATTTCTGAAGGTCCAGATGAA GAAGGTACACCACAAATCACAGGAAAGGTTGTTATTGCCATTCAAATAGTTGGAGAGGGG GAAGCTGTTCATCCACGAGTTTGTTGGCACTGTCATAAACAAGAGGTTTTGGTAGTTGGG TTTGGAAAGCGTGTATTAAGAATTGATACTACTAAAGTCGTGAAGGGTGAAGTCCCTTCT GCAGATGAGCCTCTCAAGTGTCCTGTTGAAAAGCTGATTGATGGAGTCCAATTTGTTGGT AAACATGATGGAGAAGTGACTGATTTGTCAATGTGCCAATGGATGACCACTCGTCTGGTT TCTGCTTCTATAGATGGAACAATAAAGATCTGGGAAGATCGCAAGGCACAACCACTTTTA GTATTGAGACCCTATGACGGCCATCCGGTTTATTCAGCTACATTTGTGACAGCTCCCCAC CGGCCAGATCATATTATACTTATCACAGTGGGGCCACTTAATCGGGAAGTGAAGATCTGG TCCTCGGCGAGTGAAGAAGGCTGGCTACTTCCCAGTGATGCTGAGTCATGGAAATGTACC CAGACATTAGAGCTGAAGAGTTCTGCTGAACCCCGAGTAGAGGGGGCATTCTTTAATCAA GTCATTGCTTTGTCACAGGCTGGCCTTCTCTTACTTGCAAATGCTAAGAAGAATGCTATT TATGCTGTGCACTTAGAATTTGGTCCTGATCCAGCAGCAACTCGCATGGATTATATTGCA GAATTTACTGTTACCATGCCTATTTTGAGCTTTACTGGGACAAGTATTTCACCTCATGGT GAACAGATTGTCCAGGTTTATTGTGTCCAGACACTAGCCATTCAGCAGTATGCTCTGGAA TTATCCAAGTGCTTGCCTCCACCACTGGATAATGTGGGTTTAGAAAAGTCAGATTCCAAT ATTTCACGTGAACCATCAGGGGCTGAAGGATTTGCTTTGGATCTATCTGGAAGTAAACCC ACAGAGATGCTGCTAGCTAATTCAAATTCAGCACTTAAACAAACCATACAAGATAGTAGT TCTGAGGGTGCAGTTTCCGTGAGGTATCCTGTAAGCTCTAGTTCTGTTGAGGCAACCACT TCGAAAGATATTACCACATCAAGTACAGAATCAAGACCTGTTGCATTGGCATCAGCTAAT AGTGATTCAGATGTTGTTTTTGTTGCATCACCACCTATTCCCTTGAGTCCTAGGTTGTCT GGGAAAGTTTCTGGTTTAAGAAGTCCAACAGATGGCTCTGACCCGGGTCGCACACTCAAT GAGCATGGTGGAGACCAACAAGTCAATGATTACTCAGTTGACAGGCAATTGGACAGTGTT CGTTCAAACTTGTCAGATGTGCCTGCAGTGGATGATGATTCAAGAAATATTGAGCAGAAA GTTGGACAAGATGATTTATCTAGTGTGCTCAATCCTCCGATCATGTTTAAACATCCAACC CATCTTATAACTCCCTCTGAGATTTTAATGGCTGCTTCATCTTCTGAAGGTACTAATCCT ATTGACAGCAAGAATGAAGGGGAGGCAAACATCCAAGATGTGATTGTTAACAGTGATATG GGTAATGCTGAGGTGGAGGTTAAAGTAGTGGGTGAAGCAAGATCTACTCAAAATGATGAA TTTGGATCTCAAGGAGAACCTCAAAATGTTGTTTCAGAAAATAAGGAAAAATTCTTTTGC TCCCAGGCATCAGATCTTGGAATTGAGATGGCCCGAGAATGCTGTGCAATCTCAGCCGAA ACATATACTACAGATGAAGCTCGGCAAGTTGATGATTCCAGCATGACAGAACCACTGACC CAGTCTAATGCTGGAGACGAAGACCAGGAATCTGCAAAAGATGTATCTGGGCCATGTACC ACCCCAACAGTTTTTCAATCGCATACACCAACTACAAAAGTGAAAAAACAGAAGTGGAAA AACTCTCAAGCATCAGGTCAATCTTCCCCATCACCAAGTATGCTCAATTCAATAGATTCC AACAATGAACCAGGAGGGAGTTCAAGCCCCCCCTCTGCAGAAGCTGCATTTCCTCAAATT ATGGCCATGCAGGATACGATTAATCAGCTACTGACTATGCAGAAAGAACTGCAAAAGCAG ATGACAATGATGGTTGCAGTCCCAGTTACAAAGGAGGGGAGAAGATTAGAGGCGGCTCTT GGGCGGAGTATGGAGAAGGCTGTAAAGGCCAATAATGATGCTTTATGGGCTCGTTTTCAA GAAGAGAATGCAAAGAATGAGAAGTTATTGCGAGACCGTAATCAGCAAATAACTAGTTTG ATCAATAACTTCATGAACAAGGACTTTCCAGTCATGTTAGAGAAAATGGTGAAGAAGGAA TTGGCGGTCGTTGGACCAGCTGTTGCTCGTGCTATAACTCCAGCTATTGAGAAAGCAATA CCTCCAGCTATTTCTGATTCCTTCCAGAGAGGAGTTGGTGATAAGGCAGTTAATCAATTG GAAAAATCGGTTAACTCCAAACTTGAAGCAACTGTTTCCAGGCAAATCCAGGCGCAGTTC CAAACTTCTGGCAAACAAGCTCTTCAGGACGCTCTTAAGTCTAGTATGGAAGCTTCAGTG GTACCTGCATTTGAGAAGTCATGTAAGGCCATGTTTGAGCAAGTAGATGCTACGTTCCAG AAAGGAATGCTAGAACATACAAATGCGGCACAACAACACTTTGATTCTGCACATTCGCCA CTGGCACTTGCTTTAAGGGAAGCTATTAGTTCTGCGTCATCGGTGACTCAAACCTTAAGT GGAGAAGTGGCTGATGGTCAACGTAAGCTAATAGCTCTTGCAGCTGCACGAACAAGCTCA AGTGCAGTAAATCCCCTGGTCACACAACTAACCAATGGACCTTTGGGTAGTCTCCATGAG AAGGTTGAGGTGCCTTTGGATCCAACAAAGGAGCTGTCTAGGTTGGTTTCTGAACGGAAG TATGAGGAGGCTTTCACTGGAGCTCTACAAAGAAGTGATGTGACCATCGTATCGTGGTTG TGCTCTCAGGTTGATCTGCATGGGGTATTGTTGCTGAATCCTCTTCCTCTTAGCCAAGGG GTGCTTCTCTCTCTTTTGCAACAGCTGGCCTGTGATATCAGCAATGATACATCGAGAAAA GTTGCATGGATGACAGATGTGGCGGCTGCCATAAACCCAGTAAACCAAATGATTGCAGTG CATGTGCGGCCTGTCTTCGAGCAAGTTTATCAGATACTGCACCATCAACATAGCTTGCCA ACAATCTCTAGTGCCGAGCACACAAGTATTAGACTTCTGATGCATGTCATCAACTCCATG CTGATGGCCTGTAAATGA
PEP MASSGNPNPPPQQQPQPFDMQKFFKPTNPTPLSPQSQTQNNSNQNPNPNLSSSSFPIPPA SFPPPSGPYSYPPQTAPFHHHQFQYHPHPQPHPHGNHPQIPYSPQDHHLLHQRSLSFPTP PLQPPSTYNIATAPSNPSSNNSSTSNSNPNSGARIMALLGAPSGNLELSAAQPELSVPPG VSIVPTIPMGIPPTGPTRMPSNKLPKGRHLIGDNVVYDVDVRLQGEFQPQLEVTPITKYG SDPQLVLGRQIAVNKSYICYGLKQGNIRVLNIHTALRSLFRAHTQRVTDMAFFAEDVHLL ASVSVEGRLFVWKISEGPDEEGTPQITGKVVIAIQIVGEGEAVHPRVCWHCHKQEVLVVG FGKRVLRIDTTKVVKGEVPSADEPLKCPVEKLIDGVQFVGKHDGEVTDLSMCQWMTTRLV SASIDGTIKIWEDRKAQPLLVLRPYDGHPVYSATFVTAPHRPDHIILITVGPLNREVKIW SSASEEGWLLPSDAESWKCTQTLELKSSAEPRVEGAFFNQVIALSQAGLLLLANAKKNAI YAVHLEFGPDPAATRMDYIAEFTVTMPILSFTGTSISPHGEQIVQVYCVQTLAIQQYALE LSKCLPPPLDNVGLEKSDSNISREPSGAEGFALDLSGSKPTEMLLANSNSALKQTIQDSS SEGAVSVRYPVSSSSVEATTSKDITTSSTESRPVALASANSDSDVVFVASPPIPLSPRLS GKVSGLRSPTDGSDPGRTLNEHGGDQQVNDYSVDRQLDSVRSNLSDVPAVDDDSRNIEQK VGQDDLSSVLNPPIMFKHPTHLITPSEILMAASSSEGTNPIDSKNEGEANIQDVIVNSDM GNAEVEVKVVGEARSTQNDEFGSQGEPQNVVSENKEKFFCSQASDLGIEMARECCAISAE TYTTDEARQVDDSSMTEPLTQSNAGDEDQESAKDVSGPCTTPTVFQSHTPTTKVKKQKWK NSQASGQSSPSPSMLNSIDSNNEPGGSSSPPSAEAAFPQIMAMQDTINQLLTMQKELQKQ MTMMVAVPVTKEGRRLEAALGRSMEKAVKANNDALWARFQEENAKNEKLLRDRNQQITSL INNFMNKDFPVMLEKMVKKELAVVGPAVARAITPAIEKAIPPAISDSFQRGVGDKAVNQL EKSVNSKLEATVSRQIQAQFQTSGKQALQDALKSSMEASVVPAFEKSCKAMFEQVDATFQ KGMLEHTNAAQQHFDSAHSPLALALREAISSASSVTQTLSGEVADGQRKLIALAAARTSS SAVNPLVTQLTNGPLGSLHEKVEVPLDPTKELSRLVSERKYEEAFTGALQRSDVTIVSWL CSQVDLHGVLLLNPLPLSQGVLLSLLQQLACDISNDTSRKVAWMTDVAAAINPVNQMIAV HVRPVFEQVYQILHHQHSLPTISSAEHTSIRLLMHVINSMLMACK


| Top |