Cherry SNP DataBase

Gene information

Gene Pav_sc0000422.1_g080.1.mk
Chromosome name PAV_r1.0chr2
start 9599516
end 9611622
PAV_r1.0 name Pav_sc0000422.1
start 48507
end 60613
direction -
Annotation NR hypothetical protein PRUPE_ppa000047mg
Sequence CDS ATGGCTGCTAGAGTTCTGCATAAGCTTGCAGAGCCTGTGGCACATGAAGGATCAACACCT CCTGGTGAAGTGACATATGGAGATGAAGCAGTAAAATCAGAAATAACTAATCCGGCTCCT TTAGTTGATTACTCAAACTTGTTTGAAGAAGAGTTCCAGTTGCCTGATGATCACTGGGAC TCAAGCTATCTTAACATCTTGGATATAGGAGCAGTGGAGGAAGGGATTTTACATGTTCTT TATGCTTGTGCGTCACAGATTGTAGCAACGTCGTGTTCATCATTATACCGTCCACTTCAT GCTTGTGCTGGCTATTTATCATCGTATTCACCATCGCATGCTAAGGCTGCATGCGTTTTG ATTGATCTCTGTTGTGGCATGCTAGCACCTTGGCTAAGTCAAGTGATTGCAAAGGTTGAT CTGGCTGTAGAGTTTCTAGAGGATCTTTTGGGTGTAATTCAGGGTGCATGCCACTCCCTG CTTCGTGCTCGTGCTGCCTTAAAATACATTGTTCTGGCGCTCTCTGGTCACATGGATGAT ATGCTAGGAAAGAATAAGGAAGTTAAGCATAGGATACTCTTTCTTGTGGAGATGCTGGAG CCTTTCCTTGATCCTGCTGTAGAAAGATTGAAGGGAATAATAGCCTTTGGAGATCTGTCT TCTGCACATCCAGAAAAGCAGGAAGAGAATTGTGTTATTGCCGTCAATGTAATTCGCAGA GCAGTGCAGAAACCAGCAGTTCTTCCTTCACTGGAATCTGAATGGAGGCGTGGATCAGTT GCTACTAGTGTGCTACTCTCGATATTGGAACCTCACATGCAGCTACCTCCTGAAATTGAC CTTCAAACATCTCCTGTCCCTAGACCACTGGAACCTGAATCTTTATCTGGTTTATTTCAT TCTTCAGCTTCTCACCAAGGGGTAGCTTCAAAATCAAACAGCCAGGATGAATTTGACAGG AAGATAGATGTTTCTGATACAGCCGTAAAAATTGACATTTCAGAAGACGCCAGTCTTCTT TTTGCACCTACAGAACTGCATAACATTGTATTGACAAGTATATCCAGTTGTCCTAATGAG AACAGCTCTGTCCTAACCAAAACATCTGACTGCGAGCTCAGGGCTTCTGAATTTCGGCGA TTGGCCTTAGATTTGCATTCACAGAATGAGATTACCATTGAGAGTCATGATGCCGCTATA GATGCTTTGCTCTTGGCTGCAGAGTGCGATGTCAATCCATTTTTTATGATGTCTTTTAGA GGAAATCCAAAGTTAATGAAGGAGATAAACATCAGTGGGATTAGGACTCGACAAAATCAT GAAATTGGGATGCGAATGGTCTCTGGAAAGTCTAAGAATGACCTAGAAACAATATCTCTT CTTCTTAAAAGGAAAAGAGACAAAATTGTTCTTCAAATTCTGCTCGAGGCTGCGGAGTTG TCTCCGCTTGATGTACAATCTGCAGATGCCATCACCTTGGTTCGACAAAATCAAGCTTTG TTGTGCTGCTTTCTGATTCAACGATTGCGAATGGAGCAGCACTCGGTGCATGAAATTCTT ATGCAGTGTATGATATTCTTGTTGAATTCTGCGACTAAGCTATACTGTGCTCCAGAACAT GTGATTGACATTGCATTAGGATCCGCTGAGTACTTAAATGGGATGCTAAGATCCCTGTAT TATCAGTTCAAAGCAAACAATCTGCAGTTGGAGCCGGAAACATTACATGGGATACAACGA CGGTGGATACTGCTTGAAAGATTGGTAATTTCTTCAAGCGGTGGCGATGAGGAAACAGGC TTTGCAATCAATAAAAATGGTTTCCCTTATGGAAGTCTGATTCCACCTTCAGTCTGGATG CAAAGGATTTCCACTTTTCCTAGATGCATATCCCCTCTTGTTCGATTTCTTGCTTGGATG GCAGTATCTTGTAATGCAAGACAGTACATGAAGGACCAGCTTTTACTGGCTTCTGATCTA CCACAGGTGACATCTCTATTGTCTACATTTGCAGATGAACTTTCTGTTGTAGATAATGTT ATCAGTCGAAAGTATGAAGAATCAGGGGGTGAAATTGTTTCTGCATCCATTAAAGGATTT GAAGTTGCTGATCAGCAGCATCAGGACCAATCTTTTTGTGTCATTTACCCTGAGCTCTTT AAGTTCTTTCCTAATACAAAAAAGCAATTTGAAGCTTTTGGAGAAAACATTTTGGAGGCT GTTGGGTTGCAGTTGAGGTCTTTTCCTTCCAGTATGGTGCCTGATATTTTGTGTTGGTTC TCTGATTTGTGTTCATGGCCATTTCTACATACAGAGCAGCTTTCTGCTCGAAATAGTTCT GACCGTTTAGTGTTATGGAGAGTTTTAGTTCAGACTTTGCAGTTCTTTGGTGCCATCCCA CTGGAGCTGCCCACTGAGGGACAACATGAAAGTGGACTGGAGTCACATTCATGGTTCCTC AGTGATGTCTACCACAGTTCAAGTCAAGATAAGGCCTCCGAGAAGTTAGAAGGTAACAAT GTTGGTGCTGATATTGTGAATAAAAAGGTTTATCTTTTATTTCCTGAGGAAATAGAAGAA TTCTCAAAACACTTGGAGGTTCTTATTGTTAAGCTTTACTTGACGACTGAGCTATGTTGG AATCTTCATCATCAACTATCTAAGAAGAGGACTATTACATCAACAGAGTGTTTTATGTAC TCAAGATTCTTGGCATCAATTGCACAAAGAGTTAATGACGCTCAAGGAAATGATTCTGAA ATTTCTTTCCCATCTACGTCAGTTGACCAGTTCCCTGATCATTGGAGGATTGGTATAGAA ACACTTCTTGTAGATTGTATCCCATTTGTTGAGCGACGTCTGCTGCAGTCTTTTCTCGCC GCAGCTGATAGTGTTCTTGGCTTGGGAGAGCTTGCCTGTCCAAATTGTGAGGGCCAATTG CTGAGGCTTTCATTAGCACTGATTTGCTGGTGCTTGTCTATACTACCAGGATGA
PEP MAARVLHKLAEPVAHEGSTPPGEVTYGDEAVKSEITNPAPLVDYSNLFEEEFQLPDDHWD SSYLNILDIGAVEEGILHVLYACASQIVATSCSSLYRPLHACAGYLSSYSPSHAKAACVL IDLCCGMLAPWLSQVIAKVDLAVEFLEDLLGVIQGACHSLLRARAALKYIVLALSGHMDD MLGKNKEVKHRILFLVEMLEPFLDPAVERLKGIIAFGDLSSAHPEKQEENCVIAVNVIRR AVQKPAVLPSLESEWRRGSVATSVLLSILEPHMQLPPEIDLQTSPVPRPLEPESLSGLFH SSASHQGVASKSNSQDEFDRKIDVSDTAVKIDISEDASLLFAPTELHNIVLTSISSCPNE NSSVLTKTSDCELRASEFRRLALDLHSQNEITIESHDAAIDALLLAAECDVNPFFMMSFR GNPKLMKEINISGIRTRQNHEIGMRMVSGKSKNDLETISLLLKRKRDKIVLQILLEAAEL SPLDVQSADAITLVRQNQALLCCFLIQRLRMEQHSVHEILMQCMIFLLNSATKLYCAPEH VIDIALGSAEYLNGMLRSLYYQFKANNLQLEPETLHGIQRRWILLERLVISSSGGDEETG FAINKNGFPYGSLIPPSVWMQRISTFPRCISPLVRFLAWMAVSCNARQYMKDQLLLASDL PQVTSLLSTFADELSVVDNVISRKYEESGGEIVSASIKGFEVADQQHQDQSFCVIYPELF KFFPNTKKQFEAFGENILEAVGLQLRSFPSSMVPDILCWFSDLCSWPFLHTEQLSARNSS DRLVLWRVLVQTLQFFGAIPLELPTEGQHESGLESHSWFLSDVYHSSSQDKASEKLEGNN VGADIVNKKVYLLFPEEIEEFSKHLEVLIVKLYLTTELCWNLHHQLSKKRTITSTECFMY SRFLASIAQRVNDAQGNDSEISFPSTSVDQFPDHWRIGIETLLVDCIPFVERRLLQSFLA AADSVLGLGELACPNCEGQLLRLSLALICWCLSILPG


| Top |