Cherry SNP DataBase

Gene information

Gene Pav_sc0000428.1_g690.1.mk
Chromosome name PAV_r1.0chr3
start 12919685
end 12922979
PAV_r1.0 name Pav_sc0000428.1
start 388184
end 391478
direction +
Annotation NR PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850
Sequence CDS ATGGCATCCCAAGAAGAGAAACCACTTTCTGCTAATGCTGCTGCTTCACAGCATTCACTT CAAGTCATCTTAATGGCTATTATTCTCATGTTGGTTTCTTCTTGTTTAGCACCTTCAGCT TCAGCTGCAGGACATGAAGCAGAGGCTCTCCTGAATTGGAAGGCTAGCCTTGACAACACA AGCCTGTCTCTCTTGTCTTCATGGGTTGGAAACAGCACTTGCAATTGGGATGGGATTGGT TGCAACAATATTGGAAGCATCACTCATATAAACCTCACTGGTTCTGGTTTAAGAGGTACA CTTCATTCATTCAGTTTCTCATCTTTTCCCAGTCTCCTAAGCCTCAACTTGAGCAATAAC TCAATTTCTGGAACAATCCCATCAGAAATAGGTTTTCTGAAAAGTCTTCAAATCCTTGAT CTTTCTGAAAATAACCTTAATGGGTCCATTCCCCATGAAGTTGGTTTACTGGGAAACTTA ACCATTCTTTCTCTTCATAACAATGAACTTTCTGGAAATATCCCTCTGGAAATATGTATG CTGAATTCACTCAGTGTGATTCATATAGAGAAAAACAGTCTCACAGGTTCAATTCCAGAA TCAATTGGAAACCTGTCGAACTTAACTGTTCTAGCTCTTCATCGCAACAATTTCTCTGGC TCAATTCCTTCAAGTATAGGAAACCTGACTAGGCTGAAGGAGTTGTACCTGATGGGTAAT CAATTAACTGGAACCATTCCAAATGAAGTAGGAAAGCTTCAGTTTCTTACCCTTCTAGGG TTGGTAGATAACAGACTAAATGGCTCCCTTCCTTTAGAATTGAGCAATCTTAAATTTTTG AAGTACCTGTGGCTGAGTGGCAACAACTTGTCTGGTAATATTCCCCTAGATTTATGCAGT GGTGGATTACTTGAAATGTTTACAGCACATAACAATCAGTTGACAGGCCTCATGCCTACA AGCTTGAGAAACTGCACCAGCTTAGTTAGATTGAGGCTTGAAAGGAACCAGCTAACAGGA AACATAAATGAAGAGTTTGGCATTTATCCGAAATTAGTATATGTCGACCTGAGTTATAAC AGATTCTATGGAGAGCTTTCTGAAAACTGGGGAGAGTGTCAAAACTTACAAAGCTTGAAG CTCAGCAACAACAGAATTTCTGGAAGAGTTCCTCAGTTTGAGCGATCAATTCAGCTGCAT GTACTTGACCTCTCTTCGAATAATCTCACCGGGACAATCCCAAGGGAACTAGGGAGGTTG ACATCCTTGTTCAACCTTAACCTGGGTGATAATAAACTTTCGGCTAGTGTCCCACCAGAA ATTGGAATGTTAACCAATCTACAATATCTTAACTTAGCAGCCAATGATTTCAATGGACCA ATTCCAGAACAATTAGATGGGTGCAGAGAGTTACTGAACTTGAATTTGAGCAAAAATAAA TTCAGTGAGAGCATTCCTCTTCAGATGNNNNNNNNNNTCTTCAGATGA
PEP MASQEEKPLSANAAASQHSLQVILMAIILMLVSSCLAPSASAAGHEAEALLNWKASLDNT SLSLLSSWVGNSTCNWDGIGCNNIGSITHINLTGSGLRGTLHSFSFSSFPSLLSLNLSNN SISGTIPSEIGFLKSLQILDLSENNLNGSIPHEVGLLGNLTILSLHNNELSGNIPLEICM LNSLSVIHIEKNSLTGSIPESIGNLSNLTVLALHRNNFSGSIPSSIGNLTRLKELYLMGN QLTGTIPNEVGKLQFLTLLGLVDNRLNGSLPLELSNLKFLKYLWLSGNNLSGNIPLDLCS GGLLEMFTAHNNQLTGLMPTSLRNCTSLVRLRLERNQLTGNINEEFGIYPKLVYVDLSYN RFYGELSENWGECQNLQSLKLSNNRISGRVPQFERSIQLHVLDLSSNNLTGTIPRELGRL TSLFNLNLGDNKLSASVPPEIGMLTNLQYLNLAANDFNGPIPEQLDGCRELLNLNLSKNK FSESIPLQMXXXXFR


| Top |