Cherry SNP DataBase

Gene information

Gene Pav_sc0000464.1_g850.1.mk
Chromosome name PAV_r1.0chr3
start 11719385
end 11735426
PAV_r1.0 name Pav_sc0000464.1
start 526337
end 542378
direction +
Annotation NR PREDICTED: phosphatidylinositol 4-kinase beta 1-like
Sequence CDS ATGGATGGCCCCATTTTAAAGTTCCGCCTTGGATTCTCCAAAGCTCAGGGAGATTCGCCT CGAGAGATCACCTCCAGCACCAACCTGTCGAGTGACACAGGTGAGAATGGGTGGCTCATT CGGTTCTTTGACTCGGCATTTTTCTGCGAGTGGATCGCTGTTAGCTACCTATACAAGCAT GAGCACTCGGGGGTACGTGACTACCTTTGTAATCGAATGTACACTCTTCCCTTATCGGGT ATCGAGAGCTACTTGTTTCAAATATGTTATATGTCAGTGCACAAGCCTAGCCCGTCTTTG GATAAGTTTGTGATTGATATGTGCTCTAAGTCGCTTAAGATAGCTCTGAAGGTGCATTGG TTTTTATTGGCGGAGCTTGAAGACTCTGATGATAATGAAGGAATTAGTAGGATTCAAGAG AAGTGTCAGATTGCGGCCACTTTGATGGGTGAGTGGCCGCCTTTGATACGTCCTCAAAGT GAGTCGGCCAGCCCTGGGAGCAAGAACCAGGTATTGAATAAAATATTGTCATCAAAACAG AAGTTGTTGTCACTAACGTCTTCCCCACCTGCTCAGAGGTCTTTTTCTTTCTCGCCTTCA TCAGGGAACAATCTGCAAGAGGATGGTGGTCTGTTCTCTCCTGATGAGAACAAAATATTT AAAAAATTCATACCAGGGCCAAAGGTTCGAGATGCATTGCTCTTTAGGAAGTCGGTGGAG AAAGATGAGGATGACTCTGAAAAAGATGGGTTCTTTAAGAGGCTTTTAAGGGACAGTAGG GGTGATGATGAGATGGGTTCTAAGATTAGAGATTCTTTGCTTTTCAGGAAGTCGTCAGAG AAGGACGATGATGATGCAGAAAAGGATGGGTTCTTTAAGAGGCTATTAAGGGACAGTAGA GGTGATGATGAGGAATTGACATCAAGCTCAGACGGATTTTTTAAGAGATTGTTTCGTGAT AGTAAGAGTGATTCTGACGATAAATCAATTTCTAAATCAGTGGAAGATGAAGAAAAAGAT GGGTTCTTTCGGAAGTTTTTCAAAGATAAATTTGAGGACAAAAAAGATCGAATTGATAAG AATATAGATGAGGATGCACCGTACTCTGAAGAAAGATGTTCAAGATCAGCTGAAGATGAT GAAAAAGAGGGTTTCTTCCGAAAACTCTTCAGGGATAAGTTTGACGACAAGAAAGATGGG AATGATAAAACTGAGGAAGGGAGTGCCAATGGAGAGGAAGAAGAGCCTTCTGACTTTTCA TTGTTCCGAAGATTGTTCCGTGTGCACCCTGAAGATGCGAAAAGTACTGCTGCCACTGAA AACAGCAATAATGGTGGCTTGTTAGAAAGTAGTCCAGGGACTGAGAGTTTTTTCCGCAAA TTGTTTAAAGATCGTGACCGTTCAGTTGAAGACTCGGAGCTATTTGGTTCAAAAAAACAC AAAGAGAAACGCCCTGGTTCTCCAAAGCAACAAAATGAAAAGTCAAGTGCAAAACCCCCA CTTCCAAATAATACAGCATCCCAATACCGTAAAGGGGCTTATCATGAGTCGTTGGACTTT GTGCAGTCACTATGTGAGACGTCGTATGGTTTAGTGGATATATTTCCAATTGAAGATCGC AAGAGTGCTCTTCGTGAGTCACTTGCAGAGATCAATTTGCACATTGATGAGGCTCAAAAT AGTGGAGGAGTTTGCTTTCCAATGGGGAAGGGGATGTATCGCGTGGTTTATATTCCGGAA GATGAAGCTGTTCTTTTGAATTCTAGGGAAAAGGCACCTTATCTAATCTGTGTTGAAGTC TTGAAAAGTGAAATTCCAGGCAATCCAAAGGACATATCCGGTTCTCAAAAGCTTTCTCGA GGAGGAATTCCTTTAGCAAATGGGGATGCACTTCTGACAAGACCACCTCCCTGGGCCTAT CCATTGTGGACTGTCCAGGAGGTCTATCGTAATAGTAATGATAGGATGTCGAGCTCTACT GCTCAAGCAATTGACCAGGCAATGTCACATACGTCAGAGGCAAAAGTGAAATTTGTTACT GTTAAAATATCTGTGGAGAAGAAATTGCATGGCCAGACAGTGAAAGCAGAGAATATATCA GGGAGTTGTCAACGTGGAGAGGCTGTAACTGCGTCAAAAGTAGCACAAGGGAGTGATTTG GAGTGGGTAAGGGTAGTGCTTACTGCAGATCCTGGTGTTAGAATGGAGGACATTGAGGAT CAAGGACCCCCTCGACGAAAGGAACATCGTCGTGTTCCAAGTACAGTGGCTATAGAGGAA GTAAAGGCTGCTGCAGCGAAAGGAGAAGCTCCTCCTGGACTCCCTCTGAAAGGGGCTGGT CAGGATTCGTCAGATGCACAGCCAATGGCTAATGGCAGTACTCCCGAGGCCAGCAATGCC TTGTCTGGCGAACTTTGGGAGGTAAAGAAGGAGAGGATACGCGAAGCTTCAGTTCATGGA AAACTACCTGGTTGGGACTTGCGCTCTGTTATTGTGAAGAGTGGTGATGATTGTAGGCAG GAGCATCTTGCTGTGCAACTTATTTCTCACTTTTATGATATATTCCAAGAAGCTGGTCTT CCCCTCTGGTTGCGCCCTTATGAAGTCTTAGTTACTTCTTCCTACACAGCTCTCATTGAA ACAATTCCAGATACGGCTTCACTTCATTCTATCAAAAGTAGATATCCCGATATCACGAGC TTGCGAGACTTCTTTGTTGCTAAGTATCAAGAAAATTCTCCAAGTTTTAAACTTGCCCAG GTAATCTCCAACCCGATGAAGCAGGTTGCTTTCAAAATGTCTTCTGATTAA
PEP MDGPILKFRLGFSKAQGDSPREITSSTNLSSDTGENGWLIRFFDSAFFCEWIAVSYLYKH EHSGVRDYLCNRMYTLPLSGIESYLFQICYMSVHKPSPSLDKFVIDMCSKSLKIALKVHW FLLAELEDSDDNEGISRIQEKCQIAATLMGEWPPLIRPQSESASPGSKNQVLNKILSSKQ KLLSLTSSPPAQRSFSFSPSSGNNLQEDGGLFSPDENKIFKKFIPGPKVRDALLFRKSVE KDEDDSEKDGFFKRLLRDSRGDDEMGSKIRDSLLFRKSSEKDDDDAEKDGFFKRLLRDSR GDDEELTSSSDGFFKRLFRDSKSDSDDKSISKSVEDEEKDGFFRKFFKDKFEDKKDRIDK NIDEDAPYSEERCSRSAEDDEKEGFFRKLFRDKFDDKKDGNDKTEEGSANGEEEEPSDFS LFRRLFRVHPEDAKSTAATENSNNGGLLESSPGTESFFRKLFKDRDRSVEDSELFGSKKH KEKRPGSPKQQNEKSSAKPPLPNNTASQYRKGAYHESLDFVQSLCETSYGLVDIFPIEDR KSALRESLAEINLHIDEAQNSGGVCFPMGKGMYRVVYIPEDEAVLLNSREKAPYLICVEV LKSEIPGNPKDISGSQKLSRGGIPLANGDALLTRPPPWAYPLWTVQEVYRNSNDRMSSST AQAIDQAMSHTSEAKVKFVTVKISVEKKLHGQTVKAENISGSCQRGEAVTASKVAQGSDL EWVRVVLTADPGVRMEDIEDQGPPRRKEHRRVPSTVAIEEVKAAAAKGEAPPGLPLKGAG QDSSDAQPMANGSTPEASNALSGELWEVKKERIREASVHGKLPGWDLRSVIVKSGDDCRQ EHLAVQLISHFYDIFQEAGLPLWLRPYEVLVTSSYTALIETIPDTASLHSIKSRYPDITS LRDFFVAKYQENSPSFKLAQVISNPMKQVAFKMSSD


| Top |