Cherry SNP DataBase

Gene information

Gene Pav_sc0000474.1_g280.1.br
Chromosome name PAV_r1.0chr5
start 1404507
end 1404869
PAV_r1.0 name Pav_sc0000474.1
start 154388
end 154750
direction +
Annotation NR
Sequence CDS ATGAAAAGTGCCAAGTCATATGTGGTTTGTGATACTCATGGCAATGTAATCAAAGACTAT CATGATAGTTGTCTGGTTTTGAAGAGATTTATGTTGTCAAAGCTTTCAGCTGAATTTATC GATGATCCATTATTGTTCGAGGAAGGTTCTCAATTATTTTGCCAACCTTTTGAAGGTCTA AAGCCGAAACTGAAGTCTTTTGTGAAGGAAGATTTTTGCACCCATTTAGTGCGGAAGATG TGGGAACTAGTTTTGACGAAGTTAGTTGGAAGGATCTGCAGCGGGTGTGATGAAAGGCAG TTCAAAAAGAGTAAAAGGAGGGAAGAAAAAGGCTGTAGATCAATTGAGATGGCATTGCAA TGA
PEP MKSAKSYVVCDTHGNVIKDYHDSCLVLKRFMLSKLSAEFIDDPLLFEEGSQLFCQPFEGL KPKLKSFVKEDFCTHLVRKMWELVLTKLVGRICSGCDERQFKKSKRREEKGCRSIEMALQ


| Top |