Cherry SNP DataBase

Gene information

Gene Pav_sc0000481.1_g220.1.mk
Chromosome name PAV_r1.0chr4
start 5458278
end 5487403
PAV_r1.0 name Pav_sc0000481.1
start 159364
end 188489
direction -
Annotation NR PREDICTED: ABC transporter C family member 2-like
Sequence CDS ATGGGTTTTGTTCCTTTGGATTGGTATTGTCGTCCGGTGGCCCATGGGGTGTGGACAAAA GCGGTGGAGAATGCGTTTGGTGCATACACGCCATGCGCGGTTGATTCTTTAGTTGTCTCC ATTTCTCATTTGGTTCTTCTGGGTCTCTGCATCTATCGAATATGGCGGATCAAGAAGGAT TTCAAAGCCCAAAGGTTCTGTTTGCAGTCCAACGTTTACAATTATGTATTGGCGTTATTG GCTGGTTATTGCACCGCCGAGCCTTTGTTCAGGCTGATCATGGGAATTTCAGTGCTGAAT TTAGATGGGCAGTCTGGCTTTGCACCATTTGAGGTGGTTTCTCTAATCTTAGAGGCTCTT ACTTGGTGCTCTATGCTGGTCATGATTGGTGTGGAAACTAAGATCTACATCCGTGAGTTT CGATGGTTTGTTAGATTTGGAGTAATTTATACTTTAGTGGGGGATTCTGTGATGCTGAAT CTCATTCTTTCACTAAGGGACTTATACGACAGATCTGTACTATACTTGTACATCAGTGAA GTTGCTGCCCAGGGTTTGTTTGGAATACTTTTGCTTGTGTATGTTCCAAATCTGGTTACT TATCCTGGTTATACTCCAATCCATACTGAATCAATTGATGATGCTGCGTATGAAGCACTT CCTGGAGGGGAGCAAATATGTCCTGAGAGGCATGCCAACATATTTTCAAGAGTACTGTTT TCATGGATCAATCCCCTTATGAAACTAGGCTATCAAAGACCCCTCACAGAGAAAGATGTC TGGAAATTGGATACTTGGGATCGGACTGAAACACTAAACAATAAGTTCCAAAGATATTGG GCTGAGGAACGTCGAAAGCCTAAACCATGGCTTTTAAGAGCATTGAGCTCTAGCCTTGGA GGAAGGTTTTGGTGGGGAGGCTTTTGGAAGATTGGCAATGATCTTTCCCAATTTGTGGGG CCACTTATTTTGAACCACCTCTTACAGTCTATGCAACGCGGGGATCCAGCATGGATTGGT TACATCTATGCCTTCTCAATATTTGCTGGAGTGGTTGCTGGCGTGTTATGTGAAGCTCAG TATTTTCAAAATGTCATGCGTGTTGGCTTCCGTCTACGGTCAACCTTGGTTGCTGCTGTG TTTCGGAAATCTTTAAGGCTTACTCATGAAGCTCGAAAGAACAAATATCCCAATCTCTTC ACACTTTATGGTCAGCTCCATTTCGTATCATTATCTCCATGGTTCTTCTTTATCAGCAAT TGGGCGTTGCTTCACTACTTGACATTTGTGATAAGCAAAATGCAGAAATTGTCTAAGGAG GGGTTGCAACGTACAGACAAGAGAATTGGCCTCATGAATGAAATTTTGGCTGCAATGGAC ACTGTGAAGTGTTATGCATGGGAGAGTAGTTTCCAATCCAAGGTACAAAGTGTTCGAACC GATGAATTGTTCTGGTTTCGAAAAGCATCACTGTTGGGAGCGTGTAATGGATTTTTACTA AATAGCATCCCAGTTGTAGTCACTGTGATTTCATTTGGATTGTTCACCTTGCTTGGGGGG GATCTTACACCTGCAAGGGCATTTACATCACTTTCTCTGTTTGCTGTGCTTCGGTTTCCT CTATTCATGCTTCCTAATATAATAACTCAGGTGGTTAATGCTAATGTATCCTTAAAACGC TTGGAGGAGCTACTTTCAGCTGAAGAGAGAGTACTTCTGCCAAATCCTCCTCTTGATCCA GGATTGCCAGCCATCTCAATTAAGAATGGATACTTTTCTTGGGATTCAAAGGTACGTGAC AACATTTTATTTGGATCCTTCTTTGAATCTGCGAGATATGAGAAGGCAATAGATGTGACT GCATTGAGGCATGACCTTGACTTACTGCCTGTTTTTGATAAATGCATCAGGGGAGAATTA AGAGGGAAAACCAGGGTTCTTGTTACAAATCAGCTGCATTTTCTTTCACAAGTTGATAGA ATCATCCTGGTCCATGAAGGTATGGTGAAAGAGGAGGGAACGTTTGAGGAGCTTTCCAAT AATGGCACGCTGTTCAAAAAGCTGATGGAAAATGCCGGCAAGATGGAAGAGTATGCAGAA GAAAAAGAAGGCGGCGAAACAATTGATCAGAATGGTGAAATGATTGATCAGAATGCCTCT TCAAAACCTATTGCCAATGGAGTTGTTAATGTTATGCCAAAAGATGCAAGCCGTGTGAAA AAACCAGAAGGAAAATCTGTTCTTATCAAACAAGAAGAACGAGAAACAGGCGTTATTAGC TGGAATGTCTTGGCAAGGTATAAGAATGCATTAGGAGGCTTGTGGGTGGTCATGATACTC TTTACATGCTATGTTTCAACTGAGGTTCTACGAGTTTCAAGTAGCACATGGTTGAGCCAT TGGACTGATCAAGGCATGATGGGGAATTATGACCCTGGTTTCTACAATCTGATATATGCA CTTCTATCATTTGGTCAGGTTATGGTGACACTGGCAAACTCTTATTGGTTGATTATTTCT AGTCTTTATGCTGCCAGGAGGTTGCATGAGGCCATGGTTAGCTCTATATTAAGAGCTCCA ATGGTCTTCTTCCAGACTAATCCCCTTGGACGTATCATAAATAGATTTGCAAAGGATCTT GGAGACATTGATCGGAATGTTGCTCCATTTGTCAATATGTTTCTTGGCCAAGTGTCTCAG CTCCTTTCTACCTTCATCTTGATAGGGATTGTGAGCACTATGTCCTTGTGGGCCATTATG CCCCTTCTGGTTTTGTTTTATGCAGCCTATCTCTACTATCAGAGCATGGCTCGTGAGGTA AAGCGCATGGACTCCATCAGCAGATCTCCTGTTTATGCACAATTTGGAGAAGCACTGAAT GGTTTAGCAACTATTCGTGCATATAAGGCTTATGATCGGATGTCAGACATTAATGGAAAA TCTGTGGACAACAATATCAGATTCACACTGGTGAACATGAGTGGAAACCGCTGGCTTGGA ATCCGTTTGGAAACATTGGGAGGCCTCATGATATGGTTTACAGCTACCTTTGCTGTTATG CAGAATGGAAGGGCAGAGAACCAGCAGGAGTTTGCATCCACTATGGGCCTACTTCTCAGT TATGCGCTTAATATTACAAGTTTATTGACTGGTGTACTGAGACTTGCAAGCCTGGCTGAG AATAGCTTAAATGCTGTTGAGCGGGTTGGTACATATATAGATTTGCCTTCAGAGGCTCCA GCTATAATTGAGAGCAACCGCCCCCCTCCAGGATGGCCTTCATCTGGATCTATCAAGTTC GAGGATGTTGTTCTACGTTATAGACCCGAACTTCCTCCAGTTTTGCATGAGCTGTCTTTC TCAATTTCTCCAAGTGACAAGGTTGGAATTGTTGGAAGGACCGGGGCAGGGAAGTCCAGC ATGCTAAATGCTTTATTTCGGATCGTTGAATTAGAAAGAGGAAGAATTTTGATTGATGAT TGTGATATTGCTAAGTTTGGATTGACAGATCTACGTAAAGTTCTTGGTATTATACCACAG TCACCAGTTCTTTTTTCAGGAACTGTGAGGTTTAATCTTGATCCTTTCCATGAACATAAT GATGCTGACCTCTGGGAAGCTTTAGAAAGGGCACATTTGAAAGATGCCATCAGGAGGAAT TCTTTGGGACTAGATGCTGAGGTCTCGGAGGCAGGAGAGAATTTCAGTGTTGGACAGCGG CAACTATTAAGTCTTTCTCGTGCTCTGTTGCGGAGATCAAAAATACTCGTTCTTGATGAA GCAACTGCAGCTGTTGATGTCCGAACTGATGCTCTTATTCAAAAAACTATTCGTGAAGAA TTTAAATCATGTACAATGCTCATCATTGCTCATCGTCTTAATACCATTATTGACTGCGAC CGAATCCTTCTGCTTGATGCTGGTCGGAGGAGATGGCTGGCATCTTCTCGCTGGGCTGCA GCTGCCCAGTTTGCCGTTGCTGTGAGCCTCACTTCATCGCAGAATGACCTTCAACGGTTG GAAATTGAAGATGAGAACAGTATCCTCAAGAAGACCAAGGACGCGGTGATAACTCTCCGA GGAGTTTTGGAAGGGAAGCATGATAAAGTGATTGAAGAGTCTCTTGATCAATACCAGATC TCTAGAGATGGGTGGTGGTCAGCTCTCTACAGAATGGTTGAAGGTCTTGCTGTAATGAGC AGGTTGGCCAAGAATAGGCTTCAGCAGTCGGAATATGGTTTTGAAGATAGAGCAGTTGAC TGGGACCATACTGACATGAAGTGTTTTATGTGGGGAAGTTGA
PEP MGFVPLDWYCRPVAHGVWTKAVENAFGAYTPCAVDSLVVSISHLVLLGLCIYRIWRIKKD FKAQRFCLQSNVYNYVLALLAGYCTAEPLFRLIMGISVLNLDGQSGFAPFEVVSLILEAL TWCSMLVMIGVETKIYIREFRWFVRFGVIYTLVGDSVMLNLILSLRDLYDRSVLYLYISE VAAQGLFGILLLVYVPNLVTYPGYTPIHTESIDDAAYEALPGGEQICPERHANIFSRVLF SWINPLMKLGYQRPLTEKDVWKLDTWDRTETLNNKFQRYWAEERRKPKPWLLRALSSSLG GRFWWGGFWKIGNDLSQFVGPLILNHLLQSMQRGDPAWIGYIYAFSIFAGVVAGVLCEAQ YFQNVMRVGFRLRSTLVAAVFRKSLRLTHEARKNKYPNLFTLYGQLHFVSLSPWFFFISN WALLHYLTFVISKMQKLSKEGLQRTDKRIGLMNEILAAMDTVKCYAWESSFQSKVQSVRT DELFWFRKASLLGACNGFLLNSIPVVVTVISFGLFTLLGGDLTPARAFTSLSLFAVLRFP LFMLPNIITQVVNANVSLKRLEELLSAEERVLLPNPPLDPGLPAISIKNGYFSWDSKVRD NILFGSFFESARYEKAIDVTALRHDLDLLPVFDKCIRGELRGKTRVLVTNQLHFLSQVDR IILVHEGMVKEEGTFEELSNNGTLFKKLMENAGKMEEYAEEKEGGETIDQNGEMIDQNAS SKPIANGVVNVMPKDASRVKKPEGKSVLIKQEERETGVISWNVLARYKNALGGLWVVMIL FTCYVSTEVLRVSSSTWLSHWTDQGMMGNYDPGFYNLIYALLSFGQVMVTLANSYWLIIS SLYAARRLHEAMVSSILRAPMVFFQTNPLGRIINRFAKDLGDIDRNVAPFVNMFLGQVSQ LLSTFILIGIVSTMSLWAIMPLLVLFYAAYLYYQSMAREVKRMDSISRSPVYAQFGEALN GLATIRAYKAYDRMSDINGKSVDNNIRFTLVNMSGNRWLGIRLETLGGLMIWFTATFAVM QNGRAENQQEFASTMGLLLSYALNITSLLTGVLRLASLAENSLNAVERVGTYIDLPSEAP AIIESNRPPPGWPSSGSIKFEDVVLRYRPELPPVLHELSFSISPSDKVGIVGRTGAGKSS MLNALFRIVELERGRILIDDCDIAKFGLTDLRKVLGIIPQSPVLFSGTVRFNLDPFHEHN DADLWEALERAHLKDAIRRNSLGLDAEVSEAGENFSVGQRQLLSLSRALLRRSKILVLDE ATAAVDVRTDALIQKTIREEFKSCTMLIIAHRLNTIIDCDRILLLDAGRRRWLASSRWAA AAQFAVAVSLTSSQNDLQRLEIEDENSILKKTKDAVITLRGVLEGKHDKVIEESLDQYQI SRDGWWSALYRMVEGLAVMSRLAKNRLQQSEYGFEDRAVDWDHTDMKCFMWGS


| Top |