Cherry SNP DataBase

Gene information

Gene Pav_sc0000481.1_g250.1.mk
Chromosome name PAV_r1.0chr4
start 5436077
end 5438173
PAV_r1.0 name Pav_sc0000481.1
start 208594
end 210690
direction -
Annotation NR PREDICTED: glucan endo-1,3-beta-glucosidase 2-like
Sequence CDS ATGAGAAAGAACATATGGGTTTTGGTTCTGCAGTGCTTGTTGCTCCTGGGATGCTACCTG GTTTCGACAATGGAACTTGCGATGGAAGAGAAGGCGGATGAAGCAATCCCAGTAACCACA ATGTCACCACCAGAAGGGAACACAACATTCCTTGATGGCACAACATGGTGTGTGGCCCTT CCCGGGGTTTCCCAAGTTGATTTGCAGAATGCATTAGACTGGGCCTGTGGATTGGGAATG GCAAACTGCAAGGCAATCCAAGAAGGCGGAGCCTGTTATGAACCGGATACTCTCTTGTCT CATGCCTCCTTTGCTTTCAATGATTACTATCAACAGAATGGGAATTCTGATATAGCTTGC AATTTTGGAGGAACTGCTGCAGTCACTAAATATAACCCGAGTCATGGAAAATGTGTCTTT GATGCAGCTGGAGTAGCCTCTGCAGCACCTCCATTGTACAAGCTTAATCCGAGCTCTGTT TGGTGGCAACTTGCTTGCCTTTTATTGCCTTTGTATCTAGGAAGCTGA
PEP MRKNIWVLVLQCLLLLGCYLVSTMELAMEEKADEAIPVTTMSPPEGNTTFLDGTTWCVAL PGVSQVDLQNALDWACGLGMANCKAIQEGGACYEPDTLLSHASFAFNDYYQQNGNSDIAC NFGGTAAVTKYNPSHGKCVFDAAGVASAAPPLYKLNPSSVWWQLACLLLPLYLGS


| Top |