Cherry SNP DataBase

Gene information

Gene Pav_sc0000484.1_g490.1.mk
Chromosome name PAV_r1.0chr3
start 19274607
end 19276814
PAV_r1.0 name Pav_sc0000484.1
start 212783
end 214990
direction -
Annotation NR PREDICTED: transmembrane emp24 domain-containing protein p24delta9
Sequence CDS ATGTCCCATATCCATTTTTCTGGAATTTTGATTTTGGGGTTATTGTCAACAATGGCGCAT TCAATGCGTTTCGACCTTCAATCGGGCGCCACCAAGTGCATTTCAGACGACATAAAGAGC AGTGCCATGACGGTGGGCAAGTATTCCGTCGTTAACCCCAACGAGGGCTTTCCTAAACCT GATTCTCATAAGGTCACTGTCAGGGTGACCTCACCTTATGGAAGTAATTATCACTATGGG GATCACGTGGAATCGGGTAATTTTGCGTTTACTGCGGCAGAGACTGGTGATTATTCAGCT TGCTTTTGGGTGTCTGATCATAAGCCCTCGACCACGGTGACCATTGATTTTGACTGGAAA ACTGGAGTTGCTGCTAAGGACTGGTCCAAGGTTGCCAAGAAAGGGCAGATTGAAACGATG GAAATTGAGCTGACAAAATTATATGATACTGTCTCATCCATTCATGATGAGATGTTTTTT CTTCGTGAAAGGTATAGCCACGTGTTTCTCCCCTTAGTATTTTTTGCCAGTTAA
PEP MSHIHFSGILILGLLSTMAHSMRFDLQSGATKCISDDIKSSAMTVGKYSVVNPNEGFPKP DSHKVTVRVTSPYGSNYHYGDHVESGNFAFTAAETGDYSACFWVSDHKPSTTVTIDFDWK TGVAAKDWSKVAKKGQIETMEIELTKLYDTVSSIHDEMFFLRERYSHVFLPLVFFAS


| Top |