Cherry SNP DataBase

Gene information

Gene Pav_sc0000484.1_g500.1.mk
Chromosome name PAV_r1.0chr3
start 19278077
end 19282887
PAV_r1.0 name Pav_sc0000484.1
start 216253
end 221063
direction +
Annotation NR PREDICTED: phosphate transporter PHO1 homolog 9 isoform X2
Sequence CDS ATGAAGTTTGGAAAAGAGTTTGTGCCCCAAATGGTGCCAGAATGGCAAGAGGCTTACATG GACTACAACTCTCTCAAGCTTCTCTTGAAAGACATCTTGTGTTTTAGGCAGTGCAACAAA GTAACAACACCAATGGCATCAACTCCTGAAGGGTCATCGTTGAAGAGAAGGGTGTCTCTC TACAGAGCTTTTAGTGGGCTAACAAGCCGGCATCGAGGCTCTCCGAAGAAGAAAGAGGAC GAAGAGATTCTTGTTAGTGAAGAAGGGGCAGAAGGGCAGTGGCAGACAATGTTTTTGATG TCCTCTGATGAAGGAGGAGACATTGAGGTTGTGTTTTTTAAGAGGCTTGATGAGGAGTTT AATAAAGTCATCAACTTTTACAAGAAGAAAGTTGGGGAAGTGGTGGATGAGGCAGAGGAG TTGAGCAGACAGATGGATGCTTTAATTGCTCTTAGGCTGAAGGTAGAGAATCCACTGGTG GAACTGGGAGGAACTGATGTGATAGACAGAGGAAGCAATGGGGTTTCCTCGCAATCAACT GTTCATCCGACTAGTGGCAGAAGGCCAGGAGGGCTTCAGATGGATGTGATTCCAGAAGTT GAGATGAGCAATGAAGGAGAAATGGAAGATGAAGAGAGAGGAAGCAAAGAATCAAAAACC AGTGACCAGAATATTAAGGGATTTAAACCACCTTCACTAGAGATCCTGGATCATGTAAAG ATCAATGTGACACCTGAAACTCCGGTGTCAACAGTGAAAGGCATCCTCAAGAGTTCAAAA CCAGACTTATCATTCAGCAAGAAAGAGTTGAGGAAAGCAGAAGAGCAAATGACAGAGGCT TTTAATGAGTTCTACCAAAAGCTTCGGCTTATAAAAAGTTACTGTTTCCTGAATCAATTG GCTTTTTCAAAGATCATGAAGAAATATGACAAGGTATTTGCTTTAGTCATACTAACTGTG TTAGTGCAGATCTCTTCAAGGAAAGCATCAAAGGCTTACTTGAATATGGTGGATAATTCT TATCTCGGAAGCTGTGATGAAGTTACTAGGATCATGGAAAGGGTGGAGGCTACGTTCATA AAGCACTTTACAAATGGAAATCGCAGAGAAGGAATGAAGACATTAAGACCAAGAGCCAGA AGGGAAAAGCATAGAAGGTTGTTCTCTGGGGTCTCAATTGCACTTGTAGTAGCCATTATT GTGCTTATACATGCAAGAAATATCCTTAGGAGTGAAGGGCGTGGTCAGTACATGGAAAAC ATATTTCCTCTATACAGTCGATTTTTCCTCCTCCAATGTATATTCCATTGCCTTTGTGCT CCACTTTATAAGGTTTCCCTCCCAGATTTTTTCTTGGCAGATCAGCTTACTAGCCAGGTT CAAGCCTTCAGGAGTTTGGAATTCTATGTTTGCTATTATGGTTGGGGGGACTTCAAAAAA AGATCACACAACTGCCTTGACAGCCGTGTATATAGATCTTTCTACTTCATTGTAGCAATT ATTCCTTATTGGATCCGTTCCCTTCAGTGCCTTCGACGCTTGATAGAGGAGAAAGATGGA ATGCAAGGGTTAAATGGGCTGAAATACTTTTCAACAATTCTTGCAGTAGCCATGAGAACA AGTTTTGATCTGAAAAAGGGGATGAAGTGGAAAATCCTTGCTATAACTAGTTCAGTTGTG GCAACAATTGTTAGTACATATTGGGATATAGTCATAGATTGGGGTCTTTTGCGCCGGAAT TCTAGAAACCCTTGGCTTAGAGATAAACTCCTCATATCAAACAAAAGTGTTTATTTTATA GCCATGGTGTTGAATGTTATACTGAGACTCGCTTGGATGCAGTCAGTATTAGGAATTAAA GAAGTGCCTTTTGTCCACAGAACAGCCTTAGTTGCAATAGTTGCCTGTTTAGAAATTATT CGTCGTGGCATTTGGAATTTCTTTCGGTTGGAGAATGAGCACTTGAACAATGTGGGAAAG TATCGGGCATTCAAGTCTGTACCCCTACCTTTCAACTATGACTGTGATGAGAGCAAGAGC AGATAA
PEP MKFGKEFVPQMVPEWQEAYMDYNSLKLLLKDILCFRQCNKVTTPMASTPEGSSLKRRVSL YRAFSGLTSRHRGSPKKKEDEEILVSEEGAEGQWQTMFLMSSDEGGDIEVVFFKRLDEEF NKVINFYKKKVGEVVDEAEELSRQMDALIALRLKVENPLVELGGTDVIDRGSNGVSSQST VHPTSGRRPGGLQMDVIPEVEMSNEGEMEDEERGSKESKTSDQNIKGFKPPSLEILDHVK INVTPETPVSTVKGILKSSKPDLSFSKKELRKAEEQMTEAFNEFYQKLRLIKSYCFLNQL AFSKIMKKYDKVFALVILTVLVQISSRKASKAYLNMVDNSYLGSCDEVTRIMERVEATFI KHFTNGNRREGMKTLRPRARREKHRRLFSGVSIALVVAIIVLIHARNILRSEGRGQYMEN IFPLYSRFFLLQCIFHCLCAPLYKVSLPDFFLADQLTSQVQAFRSLEFYVCYYGWGDFKK RSHNCLDSRVYRSFYFIVAIIPYWIRSLQCLRRLIEEKDGMQGLNGLKYFSTILAVAMRT SFDLKKGMKWKILAITSSVVATIVSTYWDIVIDWGLLRRNSRNPWLRDKLLISNKSVYFI AMVLNVILRLAWMQSVLGIKEVPFVHRTALVAIVACLEIIRRGIWNFFRLENEHLNNVGK YRAFKSVPLPFNYDCDESKSR


| Top |