Cherry SNP DataBase

Gene information

Gene Pav_sc0000488.1_g030.1.mk
Chromosome name PAV_r1.0chr3
start 14532442
end 14533161
PAV_r1.0 name Pav_sc0000488.1
start 15531
end 16250
direction +
Annotation NR hypothetical protein POPTR_0014s16790g
Sequence CDS ATGCTCCATAAGTTGCTTAATGTCCATAAACTCAAGCCATTTGTGCGGCATGCGCTGCCT AAGCAAGCCCCGGCAACGCAGCCACAGTCACGGCCAGAGGAGGATGGTACTTCTATCTTG AAGATTGTCCATGCAGGTGGACATGTTGAGAGCTACTACATGGCTATTCCTGCAGCCAAG ATACTGGAGAAGTACCCCTCTTTCTTGCTAGCCAGGCCTGAAGTCTTCAGGCGGCCCTGG GATTCGGTAGTGAAGGCTGAGGAGATCCTCACTCCTGGCCAAAAGGTCCTCCTAGTTCCT CGTCGAACCATGAGGAAGCTCCGGCGCAGAATAAGAAAACCCAACAAAGAATTTTCAAAA CCCAACAAAGAATTTTCTTTCAACTCTTATGTATCTCATTCTTCCATGGACGTCTCAAGT CACACAATTTCGCAACGGAAACAAGGTGCTGCAGCAGTTGGTGAGCTGAGTGACTCTTCT TCTATCTGCAGCATCATTGGAAGACAGAAAAGTGTTGGGAAGAAACATGTGACATTTAGT GGCATTGATGTGAAGCACAGGTACAAGGCTGGTGAAATGGAGCACTCAACTTCAAGTGAG AGCTCAAGTTCTCAATCTCATGGAAGGAAGAGAACGGTGAGAAGTGCCATGACATGGCAG CCCTCCCTTACAGCCATCACTGAAGCTCGGGGGGCTTATCATGTCATGAAATATAAGTGA
PEP MLHKLLNVHKLKPFVRHALPKQAPATQPQSRPEEDGTSILKIVHAGGHVESYYMAIPAAK ILEKYPSFLLARPEVFRRPWDSVVKAEEILTPGQKVLLVPRRTMRKLRRRIRKPNKEFSK PNKEFSFNSYVSHSSMDVSSHTISQRKQGAAAVGELSDSSSICSIIGRQKSVGKKHVTFS GIDVKHRYKAGEMEHSTSSESSSSQSHGRKRTVRSAMTWQPSLTAITEARGAYHVMKYK


| Top |