Cherry SNP DataBase

Gene information

Gene Pav_sc0000488.1_g060.1.mk
Chromosome name PAV_r1.0chr3
start 14517612
end 14524805
PAV_r1.0 name Pav_sc0000488.1
start 23887
end 31080
direction -
Annotation NR PREDICTED: ribonuclease E/G-like protein, chloroplastic isoform X1
Sequence CDS ATGGCATCTCTGCTTCGCTGTCCCTGCTCCACTGAAGCACTGGAGGCTAGGCGGCTCATG GACGTTCCTGAAGCTCATGCTCGTCCTCGGCGCCACAACCATCTTCTCGCCCAACGAACC CACTTCTCCTCTTGGCCCGTGAGCCTGAGATTTCTGTCGCCGTATATATGCCATCACATA CCCCTCGGAAATGCATTCGGATTCACTCTTTGTATGGCGAAGCATAGTTCTTTCCTAAGA TCCCCTATGATGTCCATGGAGAAAGGAAGGTCAAATGCTGTTGTTAAAGGAATGTGCAAG ATAGTCTGGACTATAGAGGCTGATCTGGCAGCTGGTGAGTTTCTGTACATAACTGGGGAT CCTACTGTTCTCGGCTGCTGGGAACCGGAGATTGCTATACTAATGTCTCCTACAGAACAT ACGAACTTATGGAAGGCTGAAGTCAGGATTTCTGGTGGTGTAAATTTCAAGTATAACTAT TTTATAAAGAGAGAAATGTGGCCTCCATCTGACATCATTTGGAGACCTGGACCTGAATTC TCTCTATCAGTACCCCTACCTGTCAAACAAGGTGGAAGAATTGTAGTGAGGGATTCATGG ATGAGGCCCGATACCACAATGTCTCCAATTCTTTCGTGGGGGTCATGGATAGAGGATGCA TATCTTCCAATACCACCTTTATTCTCAGCTCCAGCTAGAGATGAAGATGAGATTATGAAA TACCTTAAAAGTGATATGATAGAACCAAAGCCAGTTTTAAATCTTCATATGGAGAAGCGC ATGTTATACTCTGATAGAGAACTTACTGCAAGTGCTACCCACAAGGGCTTCATTTCCAAT ACTGACATACTAGAGTTGAACCCATCCTTAAATGAACCTATGGAGGATAACGTGTACTCT GATGGCGACCGTATAGTGAATACCAGTCAGAGGGGGTTAATTTCTAATAGTTTTTCAACT GAAAGACATCATCCTATTGAGGAACCCTGGTTACTCCAATCACCTCTCTTCTTTCTTGTG TCCAAGGATAAGATGGGTTCTGATATGTCCAAAAAGAATGGCGGCATGAAAGATTGTGTG GAAAATTTGGACGATGCAGGACAATCGTTGCCTGAAGAAAGAAATAATCTAATTTCGAAT GAACCTGTTTCTACCATTATACTGATTAATTCTTCTATATGTACCATGCAAAGGATAGCT CTACTGGAATATGGGAAATTGGTTGAGTTACTACTGGAACCCGTTAAAAGTACAGTGCAG TGTGACAGTGTGTATCTAGGGGTGGTTACAAAACTTGTCCCCCATATGGGTGGTGCATTT GTAAATATTGGGAGTTCTAGACCCTCACTAATGGACATTAAACAAAACAGAGAACCATTC ATATTCCCGCCATTCCGTAGGACAAAGAAAATGGAAGCCAATGGTTATATGCTTGATGAT CGCGTGAATGCATATGGAAATGAACCTATGCCACTTGATTACGAAGTGACTGACGACATC ATTGAAATCAGCTCTCAGGATGATTTTGTAAAATCCATTCACGATGTTGATGATGATGAT GATGATGATGATGATGAACATGAAATCGAGGATGAATTTGATGTTTCAGATGTTAAGGAA AATGTGAATGGTAGTATGCTCGACACTGGTGATGTGGGAAATGATTATCTAAAAGGTGAC ACTAGTGCTATTCCTGTTGCCATAAATGGTTCTAGCAGTTCTCAAATGTCTCACCTCCAA AATAAGAAGAATGATGCAAATATTATCGCTAATGAGAATAAGTGGGCTCGAGTTCAGAAA GGCACCAAAGTTCTTGTACAAGTTGTCAAAGAGGGGTTGGGTTCAAAAGGTCCCACACTG ACTGCTTATCCAAAATTGAAAAGCAGATTCTGGATATTATTAACTCGTTGTGATAGAATT GGAATCTCCAAAAAAATTGGCGGTGTTGAGCGTACACGATTAAAAGTCATAGCGAAAACT TTGCAGCCTCCGGGTTTTGGTTTGACTGTAAGGACTGTTGCTGCTGGCCATTCTTTAGAG GAGCTGCAAAAGGATTTGGAAGGTCTGGTTTCAACTTGGAAAAGTATTACGGAACATGCA AAATCTGCAGCACTTGCTGCAGATGAAGGTGTGGAAGGGGCCATTCCTGTTATTCTACAC CGGGCAATGGGTCAGACGCTCTCAGTTGTCCAGGATTATTTTAATGAGACGGTTGAGAAA ATGGTTGTTGACTCTCCAAGGACATATCATGAGGTTACCAGTTACCTTCAGGAGATTGCC CCTGATCTTTGTGATCGAGTTGAGTTATACAACAAAAGAATTCCTCTTTTTGATGAATTT AACATCGAAGAAGAGATCAACAACATGCTTAGTAAAAGGGTTCCACTTGCTAAGGGAGGC TCTTTAGTGATCGAGCAAACTGAGGCATTAGTCTCTGTTGATGTGAATGGAGGACATGGG ATGTTTGGTCAAGGGACTTCACAGGAGAAAGCTATTTTAGAAGTCAACCTTGCAGCTGCT AAACAAATTGCAAGGGAGTTACGACTGAGAGATATCGGTGGCATAATTGTGGTAGATTTC ATTGATATGGCTGATGAATCAAATAAGAGATTGGTCTATGAAGAAGCTAAGAAGGCTGTT GAGAGAGATAGATCAATGGTTAAAGTCTCTGAACTTTCGAGGCATGGACTTATGGAAATA ACAAGAAAGAGAGTACGACCTAGCGTGACATTTATGATTAGTGAACCATGCACTTGCTGC CATGCCACTGGGAGAGTAGAAGCACTGGAGACCTCCTTCTCCAAAATTGAACAAGAAATT TCTCGATTACTGGCGATGATGGAACAGAGACCAGACCCAGAGAACCCTAAATCCTGGCCA AAATTTATTCTGAGAGTTGACCATCACATGTGTGACTACTTAACTTCTGGGAAAAGGACA AAACTTGCATTCTTGAGCAGTTCCCTCAAAGTTTGGATTCTACTAAAGGTTGCTAGAGGT TTCACCAGGGGTGCATTTGAAGTGAAACCATTTACAGATGAAAAGGGACACAAAGATCAG CGGCAAGTAACCATTCCGATGTTACGGCCTACAGAAACCAGAACTAACAATCCTAGCAGA AAGGTGACCTTGTTTCCAGTCAAAAAGTAG
PEP MASLLRCPCSTEALEARRLMDVPEAHARPRRHNHLLAQRTHFSSWPVSLRFLSPYICHHI PLGNAFGFTLCMAKHSSFLRSPMMSMEKGRSNAVVKGMCKIVWTIEADLAAGEFLYITGD PTVLGCWEPEIAILMSPTEHTNLWKAEVRISGGVNFKYNYFIKREMWPPSDIIWRPGPEF SLSVPLPVKQGGRIVVRDSWMRPDTTMSPILSWGSWIEDAYLPIPPLFSAPARDEDEIMK YLKSDMIEPKPVLNLHMEKRMLYSDRELTASATHKGFISNTDILELNPSLNEPMEDNVYS DGDRIVNTSQRGLISNSFSTERHHPIEEPWLLQSPLFFLVSKDKMGSDMSKKNGGMKDCV ENLDDAGQSLPEERNNLISNEPVSTIILINSSICTMQRIALLEYGKLVELLLEPVKSTVQ CDSVYLGVVTKLVPHMGGAFVNIGSSRPSLMDIKQNREPFIFPPFRRTKKMEANGYMLDD RVNAYGNEPMPLDYEVTDDIIEISSQDDFVKSIHDVDDDDDDDDDEHEIEDEFDVSDVKE NVNGSMLDTGDVGNDYLKGDTSAIPVAINGSSSSQMSHLQNKKNDANIIANENKWARVQK GTKVLVQVVKEGLGSKGPTLTAYPKLKSRFWILLTRCDRIGISKKIGGVERTRLKVIAKT LQPPGFGLTVRTVAAGHSLEELQKDLEGLVSTWKSITEHAKSAALAADEGVEGAIPVILH RAMGQTLSVVQDYFNETVEKMVVDSPRTYHEVTSYLQEIAPDLCDRVELYNKRIPLFDEF NIEEEINNMLSKRVPLAKGGSLVIEQTEALVSVDVNGGHGMFGQGTSQEKAILEVNLAAA KQIARELRLRDIGGIIVVDFIDMADESNKRLVYEEAKKAVERDRSMVKVSELSRHGLMEI TRKRVRPSVTFMISEPCTCCHATGRVEALETSFSKIEQEISRLLAMMEQRPDPENPKSWP KFILRVDHHMCDYLTSGKRTKLAFLSSSLKVWILLKVARGFTRGAFEVKPFTDEKGHKDQ RQVTIPMLRPTETRTNNPSRKVTLFPVKK


| Top |