Cherry SNP DataBase

Gene information

Gene Pav_sc0000488.1_g390.1.br
Chromosome name PAV_r1.0chr3
start 14372511
end 14373920
PAV_r1.0 name Pav_sc0000488.1
start 174772
end 176181
direction -
Annotation NR PREDICTED: uncharacterized protein At4g26485-like
Sequence CDS ATGGGTCGTGGTAGGGAGAGATGGATCAAACACTACAGTAGCGCACAAGAGATATTGCTG GTTGGTGAAGGAGACTTTTCATTCTCTGCTTGTTTAGCTCGAGCATTTGGCTCTGCTCGC AACATGGTAGCAACTTCTCTCGAATCTCAAGGTTCTTTAAGGGCCAAACATAGGAGCTGT TTATCACACTTGAGTGGCTTGAAGAGGAGAGAGTGCTTGGTGTTGCATGATGTTGATGTG TATGAGATTGACCTCCATCCCGCTCTGCAATGGAGGAAATTTGATGTCATCATCTTCAAC TTTCCTCATGCAGGCCATTTCCCCTGGCTACGTGAAAGAAACCCTCAGCTCATTCAAATG CACAAGAACTTGTTGAAAGCCTTCTTCGAAAATGCCCGTGGGATGCTGAGGGAAGGCGGG GAAGTTCAAGTTGCAACCAGAGATGACTACCCATATAACAGATGCCCGTGGGATGCAGAG GAAGCAGGCCTGGTTTTGATGGAGAAAGTGTGGTTCAAAAAATGGGACTACCCTGGGTAC CAGAACAAGAGAGGGGGCGACATCAAGAGCAACAAAACGTTTCGTCTCAGAAATTGTTTC ACCTTCAAATTTGCACTGCAACAATATGAGTATGACTGTACTTGTGATGAAATGTCTGTT TGCAGCGATGACCATTATATGATTATGTGA
PEP MGRGRERWIKHYSSAQEILLVGEGDFSFSACLARAFGSARNMVATSLESQGSLRAKHRSC LSHLSGLKRRECLVLHDVDVYEIDLHPALQWRKFDVIIFNFPHAGHFPWLRERNPQLIQM HKNLLKAFFENARGMLREGGEVQVATRDDYPYNRCPWDAEEAGLVLMEKVWFKKWDYPGY QNKRGGDIKSNKTFRLRNCFTFKFALQQYEYDCTCDEMSVCSDDHYMIM


| Top |