Cherry SNP DataBase

Gene information

Gene Pav_sc0000488.1_g640.1.mk
Chromosome name PAV_r1.0chr3
start 14249895
end 14255675
PAV_r1.0 name Pav_sc0000488.1
start 293017
end 298797
direction -
Annotation NR PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3
Sequence CDS ATGGGCGTGAAACAAGCCTTGAAGAGCTTGGATGCATTTCCTCGTGCCGAAGAGCACTTG TTGCAGAAAACACAAACTGGGGCAGTTGTTTCTGTTGTTGGTCTACTTATAATGGCGACA TTGTTTGTGCACGAGCTGAGATATTATCTTACCACATATACCGTCCATCAGATGTCCGTA GACTTGAAGCGTGGAGAGACTCTTCCAATTCACATAAATATCACATTTCCATCTTTACCT TGTGATGTTTTGAGTGTGGATGCGATTGATATGTCAGGAAAGCATGAAGTGGATCTTGAC ACAAACATATGGAAACTTCGCCTGAACAGTTATGGCCACATCATCGGCACTGAATATTTG TCTGACCTTGTGGAAAAGGAACATTCTCACAAGCATGATGACGGTAAAGATCATCATGAG GACAAGGACCAGGAAATTCATTTACAAGGAGCTTTTGATCAAGCTGCAGAAGATCTCATC AAGAGGGTAAAGCATGCAATAGCAAATGGAGAAGGATGCCAGGTTTTTGGTGTTTTAGAT GTCCAAAGGGTTGCTGGAAACTTTCACATTTCAGTTCATGGATTAAACATTTTCGTTGCA CAAATGATTTTTGAAGGATCTAAAAATGTAAATGTAAGCCACATCATTCATGACTTGTCA TTTGGCCCAAAATATCCTGGGATTCACAACCCACTTGATGGGACGGAGCGCATTTTGCAT GACGCAAGTGGCACTTTCAAATATTATATAAAGATTGTTCCAACGGAATATAGGTATATC TCAAAAGAAGTTTTGCCAACCAATCAATTCTCTGTCACAGAATATTTTTCTCCTATGAAG CAGTTTGATAGGACATGGCCAGCTGTATACTTCTTGTATGATCTGTCGCCAATCACTGTA ACTATCAAAGAAGAACGCCGCAGTTTTCTCCATTTCATCACTCGGCTTTGTGCTGTTTTG GGCGGTACCTTTGCTTTGACAGGAATGCTAGATCGATGGATGTACAGGTTTCTTGAAGCA GTGACCAAACCAAATGCTAGAAGTGTACTCCGATAA
PEP MGVKQALKSLDAFPRAEEHLLQKTQTGAVVSVVGLLIMATLFVHELRYYLTTYTVHQMSV DLKRGETLPIHINITFPSLPCDVLSVDAIDMSGKHEVDLDTNIWKLRLNSYGHIIGTEYL SDLVEKEHSHKHDDGKDHHEDKDQEIHLQGAFDQAAEDLIKRVKHAIANGEGCQVFGVLD VQRVAGNFHISVHGLNIFVAQMIFEGSKNVNVSHIIHDLSFGPKYPGIHNPLDGTERILH DASGTFKYYIKIVPTEYRYISKEVLPTNQFSVTEYFSPMKQFDRTWPAVYFLYDLSPITV TIKEERRSFLHFITRLCAVLGGTFALTGMLDRWMYRFLEAVTKPNARSVLR


| Top |