Cherry SNP DataBase

Gene information

Gene Pav_sc0000493.1_g110.1.mk
Chromosome name PAV_r1.0chr1
start 19723622
end 19735046
PAV_r1.0 name Pav_sc0000493.1
start 94478
end 105902
direction -
Annotation NR UDP-galactose:fucoside alpha-3-galactosyltransferase
Sequence CDS ATGACAGGCAATGAAGGTTCTGCAGCTCAGGAAGAACAATATCACATGCAACCATCGCAG CCAATGCCCTTTGTATATGGCAGTCAGTCTGCTGACCCAACAACCAATCTTGCTGACCAG CCTTTAGAGTTTGCACCCGGGTTTAATTCTGATCATGGTCCACACCTGCAGCCCAGCTAT TCTTATCATGACCCTGCTACTACAGTGCCTTCCATGAATACCTGGTCTACTTCTGTTGCA CCTGGTGTAGGTTATCCCTCTAGTCTTCCAGTTCCATCAGGACCACAGCATGATCCTTCC ATGGCAATACCCTCTCCTGTTCCTGGGCATGCTCCACCTTCATTTGGCAGTTTTCCTGGA CTGAGCCTCCAGCCAACAATTCCATCTGCTGGTCCCCCCTTTGGTCTCACTGCAGGAACT GTAGGTCACCCTACTGCAGCCTTCCCTGGTGATGCATATGGAGTTTCTACAGTTTCTGAG CGCCCCAAAAAGGCTTCAGTGCCTAATTGGCTTAGAGAGGAAATTAAGAAAGCAGTCATC ACAAGTTCATCTATGGACCATCCTAAGGAGGAGACGCAATCCATTGAGGATGAAGGAGTT GATAGATCTTTTGGGAAGGGAGATCAAGCTGATAGCAAGAGCATCGATTCTTCTAGATCA ACTGAAGAAGAGGATGATGAGGATCAAGTGGAAGCAGCTAGGACTGCAGCAATTAACCAG GAAATAAAGCGTGTTCTAACTGAAGTTCTCTTAAAGGTTACTGATGATCTGTTTGATGAA ATTGCTACAAAAGTTCTTACTGAAGATGATCTGACACTTGAAGTTGAACAGAGCACACTG ACTTCAAACCATAAGTTATTGCCATCTCCCCCAGCAGTTTCAGCTCTCAAGGCTTCTGCA AAGGTTCTAATTCCGGCCAAGTCTAAGGAATCTGAGACTGAAGATGTCAGTGAAAAATCC AGTTCCAGTTCACCTGGTAATGTGTTAGGTCTTGCAAATTATGCAAGTGATGATGACGAT TTAGATGGTGATATTCAGAGTTCTGTTATGCCAAATTCTGGGAAAGATGCTATTCTTCAG CACTCAACTGTCAAAAAGCGTTCAAATGTTAGGCAGGATGCCACTACAAATGACAGTTCT TTGGTAGCGCTTGAAGAGCATGGTAGAAGTCAGACAATTTTAGAGAGTGATCTGGGCAAA ACCAGTTCACTTGAGCCCAAATATAACAACAATGCTGCTATTAGTGATATTAGTTATAAT AGACAAAAGAATGTTGAAAGTAGTGCCGATAAAAATCTGCCAGATGGAACTACTGCCTCT AGGCTGAAGGATACTGTAGGCACATTGAAACCTGACCTCCATAAAGAAAATGTCAAAAAA ACATCAAAAGATGACTCACAGGGTAGGGAGTCCAGGATGAAACCTGATAAGCATGATCGA CATGAGAGTAAAAATAGTTCTGTGACAGACTTCAATAAGGACTTAGAGAGTGGTAAGATT AGGACAGTTGAGAAGGGTGATGGGAATCGTAGGGGGCATGATGAGAGGCATTCGAGAAAG GAGAGGACAGATGATCGGAATGGCTCAAGAGAAAAGGTGAAGGAGCAAAGTCTTAAGCCT GTAGAAAAAGCACAGGAATCTGAATCAAGAAAAAGATCTTCCCATGCTGATGACAAAGAG GATAGAAGAGAAACAGAGAGACTCCATAGCTCTAGTGCTAAAGAAGATAACAACAGAAAA AGAGAACAGGCAAAGGATAAGGAGGATGATAGATCAAGACGTAAACATTCTACTGACTCA AGCAGGCACAAGAGAAGGCGCTCCTCTTCTGTTGGCAGTAGGGGTAGAAACAGCAAGGAC AACTTGGTTAATCATGCCAATGATTCAAGTGATGAAGCTTCTGATGATTCTAAAAGGAAG CACTCAAGGAGACGTAACTTATCACCATCACCTGTGAGGTCTAGGAGAAGACAACTTTCG CGGTCTCCACATAGCAAGCATTCTCAGCGCAGGCATTCTCCTTATTCTTCTCTTGATTCC AAAAGGTATGTTGCCATGAAATCTTTGTTGTGTATTGTTTTTCAGACATATACACGGGAA GAAGATCGAGGTCCAGATCACCTGTACGGCGGCAGAGATGATTGGAGCAATGGCGACAAT CTTGGCAACTCACATGGATCCCGCACGGCCTTGTCCTTGGTGGGAGCGCCGCTGGCTGGC TGGTTGGCGTTTCAAGTGGGAGTATGGAGTCTATGGTCAATTTGGCTATGTGGGTTGGCG TTATTTTGTCTCTCCCTGTATGCTACTCAATGCTTACTTCCTTCCCTCGAGGATCAGATC ATGAGGCCTAAGCTTAGTAAACGAGGTGCCGGCGTTTCGGAACCTCCGAGAATTATCATA TTCTCAGCTCCGAGGCCGTTCACTGGTTCTGTTGGGGCTAGGCAGAGTTTAGCTGTTCGC TCGTGGCTTGCTTTGTCCCCACAGATTGCAGTTGTGCTGTTCAGCAAAGACCCTTCTGTT GTTTCTTTCGCTGGAGCGTTTGACTCGCGGGTTTTGGTCGAACCCAACATTGATTTCACG TTCCTCGGTACCCCATTTTTTCATTCGATGATGGCAAGATCAAGGTCATTTTCATCAGAC ATTTCTGTTCTGGTTGATCCTGAAACCATTCTTTTACCTGACTTCATTTCCACCATGAAT TATGCTTACAAACTCGACCATGGTTGGCTTCTAGTTGCTTCATCACGAAATGTGTCCGAC TTCCCATTCTACTTGGATGAGGATGGAAAGCATTGGCAAAGAGAGAATGGGAAATTGATG ACGACACAGGAGGAGATTTTTGAGCAGAGTTGGCAGTCGACTCCCTGTGAAGGAAAGCTG CTTATGGCATGGAATAACAAAGATCTTCCCCTACATTCTGGAGTGCTTCCTCCTTTCTTG TATGGTAGGGGGGTGCACAACAGTTGGGTCGTCAGTGAGGCCTTGTCATCTGAGCTTAGG TTTGTATTTGATGCCAGTTGGACAATCTCAAGCTTCTATCTAGTTGATCAGGAACATCAG ACTGACTGGAATGTCGGAGGTTCCAGTGCTTCAAAATTTGAAAGAAGCTGGGAATATGCT GGAAATTCTCATATTGGGGCACTATATGGATCATTGTCTTATCTCGAAATTAATTACCGT GGCCTAGTAAAACTTTTGAAATGTGACGGGCAATATATTTTTGTCAATACAACGGAAAAC ATTGTTTGTCCGTTGGTATACCAGAGTGCAGGGAGATTATGGAAAGGAAGAATATTGCGT TTCGGGTGGAAGAAGAACACTTTGGCTTGGGCTGAGGGTGTTAAATCACTAGGCCAGTTA TCAGACTGTTCTCAGATGGTTCCAACAAAGCATACGAAACCATTAGACCTTCCATTCTCT TTAGAGACACTTCTCTCGTTCAATGCAGACAAAAATAACACAATTGTGCTTACTGCTGCG GGATATAGTTACAAGGACATGCTAATGAGCTGGGTGTGTAGATTGCGCCAACTGCAGGTC ACAAATTTTATCATTTGTGCCCTTGACCAGGAAATATACGAGTTTGCTGTCCTGCAGGGC CTGCCTGTTTTCAGGGATCCATTAGCTCCAAGTGAGATCAGCTTCAGTGATTGCCACTTC GGAACAAAATGTTTTCAGAAGGTGACAAAAGTGAAGTCCAGATTGGTTTTGAAGATACTG ATGATGGGTTACAACGTGCTTCTTAGTGATGTGGATGTATATTGGTTTAGAAACCCGCTG CCATTGCTCTACTCTTTTGGTCCTGCTGTTCTTGCAGCTCAGTCTGATGAATTCAACAAA ACAGGACCAATTAACTTACCTAGGCGCTTGAACTCTGGCTTTTACTTTGCCCGTTCTGAT GGTTCGACAATTGATGCTATGAAGAAGGTGGTGGCACATGCAGCAACTTCAGATCTATCT GAGCAGCCAAGCTTCTACGACACACTATGTGGAGAAGGGGGTTCCAATCGTGTGGGTGAC GATAGATGCTTGGAACCTGAAACAAATCTGTCCGTCCATTTCTTGGACAGAGATCTTTTC CCAAATGGTGCATATCTGGACCTGTGGCAGAGAAAAAAAGTGAGAGCAGCCTGTGTGAAG CAGGGTTGTTTTGTTCTCCATAACAATTGGATCAGCGGGAGACTGAAGAAGTTGGAAAGG CAGAGGTTCATCCAGTTGTTAGGCCTAGCCCGGAATACTGACAGTGGAAGAAACAAACAG TTGAAAGGATCTACCATAGATGAAGGATCTGCAAGTAAGGAAGTAGGAGCTCCCATATCA TTGGACTTCAGTCTACAGTCGAAGAATATTTTTGTGAGGATAGTCCACGCAGGTGGGCGA GAGGAGCTGTATCAGAATGTAGTTCCTGCATCTCTGTTGATGGAAAAGTATCCTGGGATG TGCGTTGCCCGCCCAGAAGTGTTCAAAAATCCTCAGGAGTCCTTTTTAAGGCCAGAGGAG AGCCTTTTGCCTGGTCAGAAGTATTATATAATACCAACTACTACAGCACAGAAAATTAAG CATAAACACCAAAAGAAAGCTGGGGCCAAAGAACCTGCTGAAGGCAAAGAGTCTCCAGAT GGGATCATTGTGAATGCAGGAGGTTGGGACACAGATGAATCTGTTTGCTCTGCTAAAGAT TATTATGCCTCCAAGGAAAGGGGGTCAAAACGTTTACGGAGAAAAGGTATTAGAGGAAAG AAGCCTTTTGTTCCCCCACTCCCGAAGACTAAATCATGTAGAGGATTGGGATGGGAGCCA AGTCTTACTTCTGTACAAGAGCTTTCTCCATGA
PEP MTGNEGSAAQEEQYHMQPSQPMPFVYGSQSADPTTNLADQPLEFAPGFNSDHGPHLQPSY SYHDPATTVPSMNTWSTSVAPGVGYPSSLPVPSGPQHDPSMAIPSPVPGHAPPSFGSFPG LSLQPTIPSAGPPFGLTAGTVGHPTAAFPGDAYGVSTVSERPKKASVPNWLREEIKKAVI TSSSMDHPKEETQSIEDEGVDRSFGKGDQADSKSIDSSRSTEEEDDEDQVEAARTAAINQ EIKRVLTEVLLKVTDDLFDEIATKVLTEDDLTLEVEQSTLTSNHKLLPSPPAVSALKASA KVLIPAKSKESETEDVSEKSSSSSPGNVLGLANYASDDDDLDGDIQSSVMPNSGKDAILQ HSTVKKRSNVRQDATTNDSSLVALEEHGRSQTILESDLGKTSSLEPKYNNNAAISDISYN RQKNVESSADKNLPDGTTASRLKDTVGTLKPDLHKENVKKTSKDDSQGRESRMKPDKHDR HESKNSSVTDFNKDLESGKIRTVEKGDGNRRGHDERHSRKERTDDRNGSREKVKEQSLKP VEKAQESESRKRSSHADDKEDRRETERLHSSSAKEDNNRKREQAKDKEDDRSRRKHSTDS SRHKRRRSSSVGSRGRNSKDNLVNHANDSSDEASDDSKRKHSRRRNLSPSPVRSRRRQLS RSPHSKHSQRRHSPYSSLDSKRYVAMKSLLCIVFQTYTREEDRGPDHLYGGRDDWSNGDN LGNSHGSRTALSLVGAPLAGWLAFQVGVWSLWSIWLCGLALFCLSLYATQCLLPSLEDQI MRPKLSKRGAGVSEPPRIIIFSAPRPFTGSVGARQSLAVRSWLALSPQIAVVLFSKDPSV VSFAGAFDSRVLVEPNIDFTFLGTPFFHSMMARSRSFSSDISVLVDPETILLPDFISTMN YAYKLDHGWLLVASSRNVSDFPFYLDEDGKHWQRENGKLMTTQEEIFEQSWQSTPCEGKL LMAWNNKDLPLHSGVLPPFLYGRGVHNSWVVSEALSSELRFVFDASWTISSFYLVDQEHQ TDWNVGGSSASKFERSWEYAGNSHIGALYGSLSYLEINYRGLVKLLKCDGQYIFVNTTEN IVCPLVYQSAGRLWKGRILRFGWKKNTLAWAEGVKSLGQLSDCSQMVPTKHTKPLDLPFS LETLLSFNADKNNTIVLTAAGYSYKDMLMSWVCRLRQLQVTNFIICALDQEIYEFAVLQG LPVFRDPLAPSEISFSDCHFGTKCFQKVTKVKSRLVLKILMMGYNVLLSDVDVYWFRNPL PLLYSFGPAVLAAQSDEFNKTGPINLPRRLNSGFYFARSDGSTIDAMKKVVAHAATSDLS EQPSFYDTLCGEGGSNRVGDDRCLEPETNLSVHFLDRDLFPNGAYLDLWQRKKVRAACVK QGCFVLHNNWISGRLKKLERQRFIQLLGLARNTDSGRNKQLKGSTIDEGSASKEVGAPIS LDFSLQSKNIFVRIVHAGGREELYQNVVPASLLMEKYPGMCVARPEVFKNPQESFLRPEE SLLPGQKYYIIPTTTAQKIKHKHQKKAGAKEPAEGKESPDGIIVNAGGWDTDESVCSAKD YYASKERGSKRLRRKGIRGKKPFVPPLPKTKSCRGLGWEPSLTSVQELSP


| Top |