Cherry SNP DataBase

Gene information

Gene Pav_sc0000496.1_g420.1.mk
Chromosome name PAV_r1.0chr7
start 6967258
end 6975177
PAV_r1.0 name Pav_sc0000496.1
start 236444
end 244363
direction -
Annotation NR PREDICTED: dirigent protein 21-like
Sequence CDS ATGGCCAAGACCCTCCAAAACCTCAATTCCATCTACACCATTTTCATAACCATTTTCCTC TTCTTCTTCTTCTTCTTCTTCTTCTTAACCCTTGCCAATGCAGAGGCTCACCGTTTCTCA AAACCCTTATCTCCGTCAAAACATGGTCTAAAGAAGGAGAAACTGAGCCATCTCCACTTC TACTTCCATGACATAGTGAGTGGCAGAAACCCTACAGCTGTTAGAGTTGCTGAGGCACCC ACAACAAACACTTCCCTGACTGGGTTTGGTGCTGTGGTCATGATGGACGAGCCATTGACT GTTGGGCCTGAACTGGGCTCCAAGCTTGTCGGAAGAGCACAAGGGATTTATGGGTCTGCT TCACAAAGTGAGGATGCTTTGTTGATGACCATGAACTTGGCTTTTGTTGAAGGTAAGTTT AATGGGAGCAGCCTTAGTGTTTTTGGTCGAAACGCGGTGGTTGAAGCTGTGAGAGAGATG TCAATTGTTGGTGGAAGTGGGGTTTTTCGGTTTGCTCGTGGCTATGTTCAGGCAAGGACT CTCAAGTTCAATGCAACAAGTGGAGATGCTCTTGTTGAATATGATGTGTTTGTTTTCCAC TATTGA
PEP MAKTLQNLNSIYTIFITIFLFFFFFFFFLTLANAEAHRFSKPLSPSKHGLKKEKLSHLHF YFHDIVSGRNPTAVRVAEAPTTNTSLTGFGAVVMMDEPLTVGPELGSKLVGRAQGIYGSA SQSEDALLMTMNLAFVEGKFNGSSLSVFGRNAVVEAVREMSIVGGSGVFRFARGYVQART LKFNATSGDALVEYDVFVFHY


| Top |