Cherry SNP DataBase

Gene information

Gene Pav_sc0000496.1_g570.1.br
Chromosome name PAV_r1.0chr7
start 7028563
end 7028970
PAV_r1.0 name Pav_sc0000496.1
start 297749
end 298156
direction -
Annotation NR
Sequence CDS ATGGTCCCACCAATCAAGCTACCTAATCAGTTCGTAACAACTAGCACGGGTATGTTTGTC TCCTCAACAATGGGTGCACTTCTTCTCTGGAGAAGAGCCACCGGTAGAATTCTGGGGCCC CCTTTGACGTTGAGTTACCATGACAGAAGCTTCCTGAGCACCAGTCATGGTCATTCTCTT GTTGGGAGCTTTGGAATGGTCCCACCAATCAAGCTACCTAATCAGTTCGTAACAACTAGC ACGGGTATGTTTGTCTCCTCAACAATGGGTGCACTTCTTCTCTGGAGAAGAGCCACCGGT AGAATTCTGGGGCCCCCTTTGACGTTGAGTTACCATGACAGAAGCTTCCTGAGCACTAGT CATGGTCATTCTCTATTGAGCTTCGCGACAAACATAGGCAAAGGTTAG
PEP MVPPIKLPNQFVTTSTGMFVSSTMGALLLWRRATGRILGPPLTLSYHDRSFLSTSHGHSL VGSFGMVPPIKLPNQFVTTSTGMFVSSTMGALLLWRRATGRILGPPLTLSYHDRSFLSTS HGHSLLSFATNIGKG


| Top |