Cherry SNP DataBase

Gene information

Gene Pav_sc0000500.1_g090.1.mk
Chromosome name PAV_r1.0chr8
start 308351
end 310564
PAV_r1.0 name Pav_sc0000500.1
start 38009
end 40222
direction +
Annotation NR hypothetical protein PRUPE_ppa012229mg
Sequence CDS ATGGCTAATAACGGGTTGTCCATTTGGTTCAAAAAGAAGGTCGTTGATCCTCTCCACGAA ATCCTCCGCAGGGGTGCCGAACCTAAGCTGTTGGCGTTCTCTGCAGCTCTTGGCATTACC TTGGGAGTATTCCCAATATGTGGGACAACTGTGATTCTGTGTGGGATGGCTATTGCATCG CTGGGGTCGCATTGCCATGCTCCAACTGTGATGCTGACTAATGTCCTTGCTACACCGATA GAACTGAGTTTAATTGTACCTTTCTTGCGCTTTGGTGAAATTATTTCCGGTGGAGATCAT TTTCCTTTAACTTCTGATGCTTTCAAGAAAGTTTTAACTGGCCAAGCTTCGCGTGAGGTC TTATTAAGTATTGCGCATGCGTTGTTGGGATGGCTCGTTGCTGCTCCTTTAATTTTTGCC GCACTGTACATACTCTTTCTACCGTGTTTTAAGGTGTTGGTTCCCAAGTTCAGCACTGTT CCTTTAAGCCCAAAGAAAGCACTTTCACCCACAGAAGTCAGGCCTAAGGTAAGAGATGCC TGA
PEP MANNGLSIWFKKKVVDPLHEILRRGAEPKLLAFSAALGITLGVFPICGTTVILCGMAIAS LGSHCHAPTVMLTNVLATPIELSLIVPFLRFGEIISGGDHFPLTSDAFKKVLTGQASREV LLSIAHALLGWLVAAPLIFAALYILFLPCFKVLVPKFSTVPLSPKKALSPTEVRPKVRDA


| Top |