Cherry SNP DataBase

Gene information

Gene Pav_sc0000500.1_g270.1.mk
Chromosome name PAV_r1.0chr8
start 207211
end 213492
PAV_r1.0 name Pav_sc0000500.1
start 135081
end 141362
direction +
Annotation NR PREDICTED: vacuolar protein sorting-associated protein 9A-like
Sequence CDS ATGGAGGGATCTTCATCCTCTTCGGCTATCTTCTATGATTTTCTCGATCGAATGCGAAAC CCTGCTTCCCTCGATCTCGTCCGATCCATCAAAAGCTTTATTGTCTCATTTTCGTTTTAC GCGGCCAACCCTGAAAATGACGGCAAAAAGGTTCAAGAATTCTACACAACAATGGAAGAT GCTATTAGGGATCATCCATTGTGGGCAGGTGCCACTGATCAGGAGGTTGATTGTGCAATG GAGGGTTTGGAGAAATATGTCATGACAAAATTGTTCTCCCGGACCTTTTCTTCTACTCCC GAGGATGTAAAGATTGACCTTGAAACCTCGCAGAAAATACACTTGTTGCAGACCTTCTTG AAGCCTGAGCATTTGGATATTCCAGCAGTTCTACGCAATGAAGCTTCATGGCTGCTTGCA GAAAAAGAATTGCTGAAAATTAATGCTTTCAAAGCCCCTCGTGAGAAGCTTCTGTGTGTT ATGAATTGTTGCAAGGTCATCAACAATTTATTGTTGAATGCATCAATGTCAGAAAATCAT GTACTGGCAGGAGCTGATGACTTTCTTCCTGCCAATCCTCCACAATTGCATTCCAACCTC AAATTCATTCAGTTATATCGGAGGCAGACAAAACTTGTGTCTGAGGCGGCCTATTACCTC ACCAATCTTGTCTCGGCCAAAACATTTATTTTTGAGTTAAATTCTAAATCTCTTTCTATT GATGAAATCGAATTTGAAGAGAGCATGCAAGCAGCAAGAATGACCAATAAAGAGACAGAA AAGGAAGCCACGCCCACTTTGGAAGAAAGGACAACCTTGCAAGGCCAGACCGATCCTGGC CCTTCAGCAAGATCACATGATAAAGAAAAAAGTGGTGCGTCAAATTACCCTTATATGGAC AAAGAGGCTGGGGATTTGACAATTGGAGATGTGGAGAGGTTGCTGAGTGTGTACAAACAA GTTGTTACCAAGTATACTGGTCTGTGCACAGCCGTTAAACACCTTTCTCTTTCTAGGACA GAACCCCATGTCACTAATTTAGAAGCTAGAAATGTTTTCTTAACGCAGCCCGAGGATACA GGTAAGAATTCTGATCAAGGAGTAGGGCAATGA
PEP MEGSSSSSAIFYDFLDRMRNPASLDLVRSIKSFIVSFSFYAANPENDGKKVQEFYTTMED AIRDHPLWAGATDQEVDCAMEGLEKYVMTKLFSRTFSSTPEDVKIDLETSQKIHLLQTFL KPEHLDIPAVLRNEASWLLAEKELLKINAFKAPREKLLCVMNCCKVINNLLLNASMSENH VLAGADDFLPANPPQLHSNLKFIQLYRRQTKLVSEAAYYLTNLVSAKTFIFELNSKSLSI DEIEFEESMQAARMTNKETEKEATPTLEERTTLQGQTDPGPSARSHDKEKSGASNYPYMD KEAGDLTIGDVERLLSVYKQVVTKYTGLCTAVKHLSLSRTEPHVTNLEARNVFLTQPEDT GKNSDQGVGQ


| Top |