Cherry SNP DataBase

Gene information

Gene Pav_sc0000502.1_g450.1.mk
Chromosome name PAV_r1.0chr1
start 42071046
end 42075425
PAV_r1.0 name Pav_sc0000502.1
start 219719
end 224098
direction -
Annotation NR hypothetical protein PRUPE_ppa007604mg
Sequence CDS ATGGATCTGTGCTCCCTGCACGTCAAGAGCATCAACAGAAGCCCTTTTATGCATAGGAAC TCGTTTACTGAGAAACCCATTTCTTGGAACTTCGGAAATGTGAGGCCTTCTTGGGCTGGT GTTGAAGATGGGAGGGACTTTGAGAGTGGGGTCCTGAATTCGAAGCGCAGGGTTTCCTCT AATGGGTTTCGTTCTTTGGTTGTCAGAGCCATGGGGAAGAAGAACAATAATGGAAATTCA TCTAACTCTTCCTCTTCTTCAGGAAATGGTGACCGCTCTATTCCAGAAGGTGATGGTGAA AAAGAAAATGATTCTTCAGAAAACTTTAGAGACACTTCTTCCCAGAAAAATTATCGTATA AACTTGGATTGGAGAGAGTTCAGAGCAAAGCTATATACTGGGTGGCAGGGAGAACAAGCG GAATCTGATGCTCAGAACCAAGGTGGGACTCCCTACCAATCGAAACCTCTTGGTCTGAAG TGGGCTCATCCTATTTCTGTACCTGAGACAGGCTGTGTCCTGGTTGCCACAGAAAAGCTT GACGGAGTTCGCACTTTTGAAAGAACGGTTGTTCTTCTCCTCAGATCAGGAACCAGACAC CCAGAAGAGGGGCCATTTGGAGTTGTTATCAACAGGCCACTCCACAAAAGGATCAAACAC ATGAAGCCCACTAATCTTGATCTTGCAACCACATTTTCTGATTGTTCTTTGCATTTTGGT GGGCCTCTCGAGGCAAGCATGTTTTTGTTAAAAACAGCGGGCAAGACAAAGCTTCCTGGG TTTGAAGAGGTGATCCCTGGCCTTTGTTTTGGTGCTCGTAACAGCCTGGATGAAGCTGCT GGGCTAGTAAAGAAGGGTCTTGTTAAGCCCCAGGATTTCAGATTCTTTGTTGGATATGCT GGGTGGCAGCTGGATCAGTTGACAGAGGAGATTGAATCGGATTATTGGTATGTGGCTGCT TGCAGCTCAAATTTGATTTATGGGGCTTCATCAGAGTCTTCGTCAGAAAGTTTGTGGGAA GAAATTTTGCAGCTAATGGGTGGCCAATATTCTGAATTGAGTCGAAAGCCTAAGCAGCAG GATATGTAG
PEP MDLCSLHVKSINRSPFMHRNSFTEKPISWNFGNVRPSWAGVEDGRDFESGVLNSKRRVSS NGFRSLVVRAMGKKNNNGNSSNSSSSSGNGDRSIPEGDGEKENDSSENFRDTSSQKNYRI NLDWREFRAKLYTGWQGEQAESDAQNQGGTPYQSKPLGLKWAHPISVPETGCVLVATEKL DGVRTFERTVVLLLRSGTRHPEEGPFGVVINRPLHKRIKHMKPTNLDLATTFSDCSLHFG GPLEASMFLLKTAGKTKLPGFEEVIPGLCFGARNSLDEAAGLVKKGLVKPQDFRFFVGYA GWQLDQLTEEIESDYWYVAACSSNLIYGASSESSSESLWEEILQLMGGQYSELSRKPKQQ DM


| Top |