Cherry SNP DataBase

Gene information

Gene Pav_sc0000503.1_g140.1.mk
Chromosome name PAV_r1.0chr2
start 10989336
end 10995305
PAV_r1.0 name Pav_sc0000503.1
start 78033
end 84002
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103331357
Sequence CDS ATGGATCCTCAGACTTTTATTAGGCTGTCAATAAGCTCACTGGGATTGAGGATTCCTGGA ACTGCGTTGAAGTCTGAAAAATCTGGGATTCATGCATTCTCTTCTCCATATTCGTGTGAA ATTCGCCTTCGAGGATTCCCTATGCAGACAGCGTCAGTCCCCTTAGTATCCTCTCCTGAA GCTACACTTGATTCTCATACCATTGCCTCAAGTTTTTACCTTGAAGAATCAGATATTAAA GCGTTGCTGGAACCTGGGTGTTTCTACAGTCCTCGTGCCTTTCTGGAGATTGCTATTTTC ACAGGGAAGAAGGGGTCCCACTGTGGTGTAGGGGTCAAAAGGCAGCAAATTGGGACATAT AAGCTGGAGGTTGGTCCTGAATGGGGGGAAGGAAAGCCAGTGGTTCTCTTTAGTGGGTGG ATAGGTATCGGAAAAAACAAGCAGGAGGGTGGAAAATTGAGTGCCGAGCTTCATTTGAGA GTAAGATTGGATCCTGATCCAAGGTATGTATTCCAGTTTGACGATGTCACAAAACTGAGT CCTCAGGTTGTGCAGCTTCAAGGCTCCATTAAGCAGCCTATTTTCAGTTGCAAGTTCATC CGAGACAGGGTTCCCCATGTGGATCCATTGAGCACTTACTGGTCAGGTTCTGCTAACAAT CCTGATCTCGAATCAGAGAGAAGAGAGAGAAAGGGATGGAAGGTGACCATACATGATCTC TCTGGCTCGGCTGTTGCAGCAGCCTTTATAACAACTCCATTTGTTCCATCAACAGGTTGT GATTGGGTTGCAAGGTCCAACCCAGGAGCTTGGATGATTGTTAGTCCTGATCCTTGCAGG CCTGACAGTTGGCAGCCATGGGGAAAGCTTGAGGCATGGCGTGAGCGTGGCATCAGAGAC TCCGTTTGCTGCCGATTTCGCCTTCTTTCTGAATGCCAGGAGGCAGTGGAGCTCCTCCAG TCTGAAATCCGCATCAATGCTGAAAAGGGTCCAGTTGTAGGTGGTTTTGTCATGAGCTGT AGAGTGCAAGGGGAAGGAAAGAGCAGCAAGCCATTGGTACAACTAGCCATGAGGCATGTT ACATGCGTGGAGGATGCCGCCATCTTCATGGCTCTTGCAGCTGCTGTTGATCTCAGCATT GAGGCATGTAGGCCCTTCCGCCGGAAGTTCAGGAAACCATCCTCCCATTCTATATGA
PEP MDPQTFIRLSISSLGLRIPGTALKSEKSGIHAFSSPYSCEIRLRGFPMQTASVPLVSSPE ATLDSHTIASSFYLEESDIKALLEPGCFYSPRAFLEIAIFTGKKGSHCGVGVKRQQIGTY KLEVGPEWGEGKPVVLFSGWIGIGKNKQEGGKLSAELHLRVRLDPDPRYVFQFDDVTKLS PQVVQLQGSIKQPIFSCKFIRDRVPHVDPLSTYWSGSANNPDLESERRERKGWKVTIHDL SGSAVAAAFITTPFVPSTGCDWVARSNPGAWMIVSPDPCRPDSWQPWGKLEAWRERGIRD SVCCRFRLLSECQEAVELLQSEIRINAEKGPVVGGFVMSCRVQGEGKSSKPLVQLAMRHV TCVEDAAIFMALAAAVDLSIEACRPFRRKFRKPSSHSI


| Top |