Cherry SNP DataBase

Gene information

Gene Pav_sc0000503.1_g160.1.mk
Chromosome name PAV_r1.0chr2
start 11020675
end 11023238
PAV_r1.0 name Pav_sc0000503.1
start 109372
end 111935
direction -
Annotation NR PREDICTED: glycine-rich protein A3-like
Sequence CDS ATGGACGGTGGAAGAGACAACAAAGATGAGTCTAATGACAAAGGGCTCTTTTCACAACTT GCTGGATATGCTGCTGGACACTACCCACAGCATGGATCATACCCTCCACAAGGATATGGA TATCCTCCACAAGCACATGGACCACCTGGGTACCCTCCCCCTGGTGGGTATCCTCCTCCA GGTGGGTACCCTCCTGCAGGAGGGTATCCTCCATCTGGATATCCTCCCCCTGGGGGATAT CCACCATCTGCCTATCCTGCCCCTGGTGGATATCCACCAGCTGGATATCCACCAGCCGGA TATCCACCACCCGGATATCCAGGTCCATCATCTCACCATTCAGGGCATGGACCTAATATG GGAGGGATGCTAGCTGGGGGTGCTGCAGCTGCAGCTGTTGCTTATGGGGCTCACCATCTT GTGCACGGGAGTCAGCACGGCTATGGTTATGGGGGTCACCATGGCTATGGTCATGGGAAG TTCAAACACGGTCATGGTCATGGGAAGTTCAAACATGGGAAATTTGGCAAGCGCTTTGGC TTTGGGGGCAAGTTCAAGAAATGGAAGTGA
PEP MDGGRDNKDESNDKGLFSQLAGYAAGHYPQHGSYPPQGYGYPPQAHGPPGYPPPGGYPPP GGYPPAGGYPPSGYPPPGGYPPSAYPAPGGYPPAGYPPAGYPPPGYPGPSSHHSGHGPNM GGMLAGGAAAAAVAYGAHHLVHGSQHGYGYGGHHGYGHGKFKHGHGHGKFKHGKFGKRFG FGGKFKKWK


| Top |