Cherry SNP DataBase

Gene information

Gene Pav_sc0000506.1_g030.1.mk
Chromosome name PAV_r1.0chr4
start 4251219
end 4290522
PAV_r1.0 name Pav_sc0000506.1
start 23789
end 63092
direction -
Annotation NR PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840
Sequence CDS TTACATATAAATTGTGGTGGAAAGGCAACCACCATTGGACGAATTAACTTTGAAGGGGAT CCAGACCTAGGAGGTGCAGCAAAATTTGTTCCTGTGAGACCTATCTGGGGAATCAGTACT ACTGGACATTTCTGGGATGCTAACCCCACCTCTAATGACTACATAGCAAATAATGCATCC ACACTTGGAATGAACAACTCTGAGTTGTACACAAGTGCACGCCTATCTCCTCTTTCTCTC ACGTATTATGCACGCTGTTTCGGAAATGGAAACTATACTGTGAGGCTTCACTTTTCGGAG ATAATAATCCGAGGCAATAGATCTTTTTACAGTCTTGGAAGACGGATATTTGATATCTAT ATTCAGGAGAAACTGGTGTGGAAGGATTTTGACATTGAAAAGGAAGCACAAGGGGTTGAT AAGGAGGTCATTAAGGAACTTAAAGCAGTTGAGGTTAAGAACAAAACTTTAGAGATCCGA TTTCATTGGTCTGGGAAAGGGACAACAGCTTCTCCAAAGAGAGGAACATATGGTCCTCTT ATATCAGCTATCTCTCTAGAGTCTGAGTTCCCGCCTCCTCGTGATAAGAAAAGCAAGGTA CCTATTGTGGTGGGAGCTTCAGTTGGAGCTTCGGTTTTATGCCTCATTTTCTTGATTTTA GGCATTCTTTGGTGGAAAGGCAGTCTGGATAGCAAGACATCAAGGGAAAAAGCTCTTAGA GAACTGGATCTGCAAACTGGATTTTTCACCTTCAGGCAAATTAAAGCTGCCACTAACAAC TTTGATCTTAAAAACAAAATTGGGGAAGGCGGTTTTGGGTCTGTCTACAAGGGTATATTG TTGGATGGTACTATAATCGCAGTTAAGCAACTATCTTCAAAATCAAAGCAAGGAAACCGT GAGTTTGTCAATGAAATAGGCATGATTTCTGGTTTACAACATCCGAATCTTGTTAGATTG TATGGGTGCTGCATTGAAGCAAATCAACTACTGTTGGTATATGAATACATGGAAAACAAT AGCCTTGCACGTGCTTTGTTTGGTCCAGAGGAAGGTCCATTAAAATTGGACTGGCCTACA AGGCAGAAAATATGCTTGGGCATAGCAAGAGGTTTGGCTTTTTTGCATGAGGAATCTGCA CTGAAGGTTGTGCATAGAGACATCAAAACTACGAATATATTACTGGACCATGACCTTAGC CCTAAGATCTCAGACTTTGGTTTGGCTAAGCTTGATGAAGAGGAGAACACCCACATTAGC ACCAGAGTTGCTGGAACTATAGGATACATGGCGCCTGAATATGCACTATGGGGTTATTTA ACCTACAAAGCAGATGTCTACAGCTTTGGTGTTGTTGCATTGGAAATTGTTGCTGGAAAG AACAACATGAAATATCGACCAAATGAGAATTTTGTATGCCTTGTGGATTGGGCCCTTGTT TTGCAACAAAAAGGGAATTTAATGGACCTGGTAGATCCAAGGTTGGGGTCCAATTTCAGT AAGGAAGAGGCAATTAGAATGGTTAAAGTGGCTCTGCTATGCACCAATCCTGCACCAGCC CTTAGGCCTGCTATGTCTGCAGTAGTGAGTATGCTTGAAGGGAAGACTGCTGTTCATGAA CTGATTATGGATCCAAGTATTTATGGTGATGAAATAAGGTTAACAGCTCTGAGAAACCAG TTTGATCAGATTGCACAAGAGAGCTCAACT
PEP LHINCGGKATTIGRINFEGDPDLGGAAKFVPVRPIWGISTTGHFWDANPTSNDYIANNAS TLGMNNSELYTSARLSPLSLTYYARCFGNGNYTVRLHFSEIIIRGNRSFYSLGRRIFDIY IQEKLVWKDFDIEKEAQGVDKEVIKELKAVEVKNKTLEIRFHWSGKGTTASPKRGTYGPL ISAISLESEFPPPRDKKSKVPIVVGASVGASVLCLIFLILGILWWKGSLDSKTSREKALR ELDLQTGFFTFRQIKAATNNFDLKNKIGEGGFGSVYKGILLDGTIIAVKQLSSKSKQGNR EFVNEIGMISGLQHPNLVRLYGCCIEANQLLLVYEYMENNSLARALFGPEEGPLKLDWPT RQKICLGIARGLAFLHEESALKVVHRDIKTTNILLDHDLSPKISDFGLAKLDEEENTHIS TRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWALV LQQKGNLMDLVDPRLGSNFSKEEAIRMVKVALLCTNPAPALRPAMSAVVSMLEGKTAVHE LIMDPSIYGDEIRLTALRNQFDQIAQESST


| Top |