Cherry SNP DataBase

Gene information

Gene Pav_sc0000514.1_g020.1.mk
Chromosome name PAV_r1.0chr7
start 5048011
end 5054025
PAV_r1.0 name Pav_sc0000514.1
start 4874
end 10888
direction -
Annotation NR PREDICTED: magnesium-chelatase subunit ChlH, chloroplastic
Sequence CDS ATGGCTTCTTTAGTATCTTCACCCTTCACCTTACCCAACACAAAAGCAGACCAGCTTTCT TCACTCTCCAGAAAGCAATACTTTCTTCACTCATTTCTCCCCAAAAAAGTCAACCAGAGC AGCTTAAAGTCCTCCCTCAAAGTGAAATGTGCAATGGGCAATGGCCTCTTCACCCAAACC ACTCAGGAGGTCCGGCGTATTGTGCCAGAAAATAAGCAAGGCCTCCCTACTGTGAAAATT GTCTATGTGGTCTTGGAAGCACAGTACCAATCATCACTCACTGCAGCAGTGCAGGCTTTG AACAGCAACAGCAAGTATGCTTCTTTTGAAGTTGTGGGTTACTTAGTTGAAGAGCTTCGT GATGCAGAAACTTATAAAATGTTCTGCCAAGACCTTGAGGACGCCAACATCTTCATTGGG TCTTTGATTTTTGTTGAGGAGCTTGCTGTGAAGGTGAGGGATGCTGTGGAGAAAGAGAGG GACAGGCTTGATGCAGTTTTGGTGTTTCCTTCAATGCCTGAAGTGATGAGGCTCAACAAG TTGGGTTCTTTCAGCATGTCCCAGCTTGGGCAATCCAAGAGCCCCTTTTTCCAACTTTTC AAGAGGAAGAAGCAGTCTGCTGGCTTTGCTGACAGTATGCTCAAGCTTGTGAGGACTTTG CCTAAGGTGTTGAAATACTTGCCTAGTGATAAAGCTCAGGATGCTAGACTTTATATTCTC AGTTTGCAGTTTTGGCTAGGCGGGTCACCAGATAACTTGCAGAATTTCTTGAAAATGATA TCTGGGTCTTATGTTCCTGCTCTGAAAGGCGAAAAGATTCCATATTCAGACCCAGTTCTG TTCTTGGATAGTGGAATTTGGCACCCTTTAGCACCTTGTATGTATGATGATGTGAAGGAG TACTTGAATTGGTATGGAACTAGGAAGGATGCTAATGAGAAGCTTAAGAGCCCGAATGCA CCAGTAGTCGGGTTGATTTTGCAGAGGAGTCACATTGTTACTGGGGATGAAAGTCACTAT GTGGCTGTGATCATGGAATTGGAGGCAAGAGGTGCTAAGGTGATACCAATTTTTGCTGGT GGGCTTGACTTTTCAGGGCCAGTTGAGAGGTTTCTGATTGATCCGGTTACTAAGAAACCG TTTATCCATTCTGCCATATCTCTTACTGGTTTTGCTCTTGTTGGGGGGCCAGCTAGACAG GATCATCCACGGGCTGTTGAGGCTCTGATGAAGCTTGACGTTCCATACATTGTCGCATTG CCTTTGGTATTCCAGACAACCGAGGAGTGGTTAAATAGCACTTTGGGGCTGCACCCAATT CAGGTAGCATTGCAAGTGGCTCTCCCAGAGCTGGATGGAGGCATGGAGCCCATTGTTTTT GCAGGCCGGGATCCTAGAACAGGGAAATCACATGCTCTTCACAAGAGGGTAGAACAGCTT TGCACCAGGGCAATCAGATGGGGTGAATTGAAAAGGAAGGCAAAGGCTGAGAAGAAGCTA GCAATTACAGTCTTCAGTTTCCCTCCAGACAAAGGAAATGTTGGAACAGCTGCCTATCTG AATGTTTTTTCCTCCATCTTTGCGGTTTTGCAAGAACTCAAAAGAGATGGTTACAATGTT GAGAACCTTCCAGAGACTTCAGAAGCTTTGATCGAAGATGTAATTCATGATAAAGAGGCT CAATTCAGCAGCCCAAATCTGAATGTTGCTTACAAAATGGGGGTCCGTGAATATCAAAGT CTAACTCCATATGCTACTGCATTGGAGGAAAACTGGGGAAAACCTCCTGGGAACCTGAAC TCTGATGGAGAGAATCTCTTAGTATATGGGAAACAGTACGGAAATGTCTTCATCGGAGTT CAGCCCACATTTGGGTACGAGGGTGATCCAATGAGGCTACTGTTCTCCAAATCAGCTAGC CCACATCACGGCTTTGCAGCATATTATTCATTTGTTGAAAAGATTTTCCAAGCTGATGCT GTACTACATTTTGGTACTCACGGTTCACTGGAATTCATGCCTGGAAAACAGGTGGGAATG AGTGATGCCTGTTTCCCAGACAGTCTGATTGGGAACATCCCCAATGTCTATTACTATGCT GCTAATAACCCATCTGAAGCTACCATAGCCAAGCGTCGGAGCTATGCCAACACCATCAGC TATCTGACTCCTCCTGCAGAAAATGCTGGGCTTTACAAAGGCCTTAAGCAATTAAGTGAG CTTATCTCCTCTTATCAATCCCTTAAAGACACAGGCCGTGGGTCACAGATTGTTAGCTCA ATAATCAGCACAGCTAAGCAATGTAATCTTGATAAGGATGTAGAACTACCCGAGGAAGGG GTGGAAATCTCAGCAAAAGAACGAGATCTTGTGGTTGGAAAGGTGTATAACAAAATCATG GAGATTGAGTCCCGTCTATTGCCTTGTGGGCTTCATGTCATTGGTGAGCCTCCGACAGCC ATGGAAGCTGTTGCAACTCTGGTTAACATTGCTGCACTGAACCGTCCAGAAGAAGGGATT ACTTCCCTCCCAGATATATTAGCTGATACTGCTGGAAGAGACATAGAGGACATTTATAGA GGGAGTGATAAAGGGATATTGAAGGATGTGGAGCTTCTTAAGCAAATAACTGACACATCA CGTGGAGCAATTTCTGCATTTGTGGAGCGTACAACCAATGAGAAGGGTCAAGTAGTTGAT GTAAAAGATAAACTGAGCTCAATCCTTGGGTTCGGTATAAATGAACCTTGGGTTCAGTAC TTGTCGAACACAAAGTTTTACAGGGCTGACAGGGACAAACTTAGAACATTGTTTATGTTT TTGGGAGAATGCTTGAAGCTGATTGTGGCTGACAATGAGATAGGGAGTTTGAAACAAGCA TTGGAGGGCAAATATGTAGAGCCAGGGCCTGGTGGTGACCCAATTAGAAACCCGAAAGTG TTGCCAACAGGAAAGAATATTCATGCACTTGATCCACAATCTATACCCACAACAGCAGCA ATGCAGAGTGCAAAAATTGTGGTGGAGAGGTTGATAGAGAGGCAGAAGATTGATAACGGG GGAAAGTATCCTGAGACGATAGCACTTGTTTTGTGGGGTACAGACAATATTAAGACTTAT GGTGAGTCCTTGGCTCAGGTTTTGTGGATGGTTGGTGTAATGCCAGTTGCTGATGCTTTT GGACGAGTCAACCGGGTGGAAATAGTAAGTCTTGAAGAGCTTGGAAGACCCAGAATTGAT GTTGTTGTCAACTGCTCAGGAGTTTTCAGAGACCTCTTTATCAATCAGATGAATCTGCTT GACCGTGCAGTGAAGATGGTAGCTGAACTAGATGAGCCAGTTGAGCAAAACTTTATCAGG AAGCATGCACTGGAACAAGCAGAAACCCTTGGGATTGGGGTTCGTGAAGCTGCAACTCGG ATCTTCTCCAATGCTTCAGGATCCTATTCCTCCAACATTAACCTTGCTGTGGAGAACTCC TCATGGAATGACGAGAAGCAGCTGCAAGACATGTATCTAAGCCGAAAATCTTTTGCTTTT GATTCTGATGCCCCTGGTACAGGCATGGCTGAGAATAGAAAAGTTTTTGAGATGGCTCTG AGCACAGCTGAAGCGACATTCCAAAACCTTGACTCATCAGAGATCTCACTTACTGATGTA AGCCACTACTTTGACTCGGATCCAACCAATCTGGTGCAAAACCTAAGGAAGGATGGAAAG AAACCAAGTGCTTACATTGCTGACACCACCACAGCTAATGCCCAGGTTCGCACACTCTCT GAGACCGTGCGTCTTGATGCAAGGACCAAGTTGTTGAACCCTAAGTGGTATGAAGGAATG TTATCCAGTGGATACGAGGGTGTTCGTGAAATTGAGAAAAGGCTTACTAACACAGTTGGG TGGAGTGCAACTTCCGGCCAAGTTGACAACTGGGTGTATGAAGAGGCCAACTCAACTTTC ATTCAAGATGAGGAGATGTTGAACAGGCTGATGAAAACAAATCCAAACTCCTTCAGGAAG CTGGTACAGACATTCCTGGAGGCAAATGGACGCGGTTACTGGGACACTGATGAGCAGAAT ATTGAGAAGTTGAAGGAGTTGTACTCAGAAGTTGAAGACAAGATCGAGGGAATCGATCGG TAA
PEP MASLVSSPFTLPNTKADQLSSLSRKQYFLHSFLPKKVNQSSLKSSLKVKCAMGNGLFTQT TQEVRRIVPENKQGLPTVKIVYVVLEAQYQSSLTAAVQALNSNSKYASFEVVGYLVEELR DAETYKMFCQDLEDANIFIGSLIFVEELAVKVRDAVEKERDRLDAVLVFPSMPEVMRLNK LGSFSMSQLGQSKSPFFQLFKRKKQSAGFADSMLKLVRTLPKVLKYLPSDKAQDARLYIL SLQFWLGGSPDNLQNFLKMISGSYVPALKGEKIPYSDPVLFLDSGIWHPLAPCMYDDVKE YLNWYGTRKDANEKLKSPNAPVVGLILQRSHIVTGDESHYVAVIMELEARGAKVIPIFAG GLDFSGPVERFLIDPVTKKPFIHSAISLTGFALVGGPARQDHPRAVEALMKLDVPYIVAL PLVFQTTEEWLNSTLGLHPIQVALQVALPELDGGMEPIVFAGRDPRTGKSHALHKRVEQL CTRAIRWGELKRKAKAEKKLAITVFSFPPDKGNVGTAAYLNVFSSIFAVLQELKRDGYNV ENLPETSEALIEDVIHDKEAQFSSPNLNVAYKMGVREYQSLTPYATALEENWGKPPGNLN SDGENLLVYGKQYGNVFIGVQPTFGYEGDPMRLLFSKSASPHHGFAAYYSFVEKIFQADA VLHFGTHGSLEFMPGKQVGMSDACFPDSLIGNIPNVYYYAANNPSEATIAKRRSYANTIS YLTPPAENAGLYKGLKQLSELISSYQSLKDTGRGSQIVSSIISTAKQCNLDKDVELPEEG VEISAKERDLVVGKVYNKIMEIESRLLPCGLHVIGEPPTAMEAVATLVNIAALNRPEEGI TSLPDILADTAGRDIEDIYRGSDKGILKDVELLKQITDTSRGAISAFVERTTNEKGQVVD VKDKLSSILGFGINEPWVQYLSNTKFYRADRDKLRTLFMFLGECLKLIVADNEIGSLKQA LEGKYVEPGPGGDPIRNPKVLPTGKNIHALDPQSIPTTAAMQSAKIVVERLIERQKIDNG GKYPETIALVLWGTDNIKTYGESLAQVLWMVGVMPVADAFGRVNRVEIVSLEELGRPRID VVVNCSGVFRDLFINQMNLLDRAVKMVAELDEPVEQNFIRKHALEQAETLGIGVREAATR IFSNASGSYSSNINLAVENSSWNDEKQLQDMYLSRKSFAFDSDAPGTGMAENRKVFEMAL STAEATFQNLDSSEISLTDVSHYFDSDPTNLVQNLRKDGKKPSAYIADTTTANAQVRTLS ETVRLDARTKLLNPKWYEGMLSSGYEGVREIEKRLTNTVGWSATSGQVDNWVYEEANSTF IQDEEMLNRLMKTNPNSFRKLVQTFLEANGRGYWDTDEQNIEKLKELYSEVEDKIEGIDR


| Top |