Cherry SNP DataBase

Gene information

Gene Pav_sc0000514.1_g200.1.mk
Chromosome name PAV_r1.0chr7
start 4932081
end 4944919
PAV_r1.0 name Pav_sc0000514.1
start 113980
end 126818
direction +
Annotation NR PREDICTED: RRP12-like protein
Sequence CDS ATGGACGAAGAACACCACCACGACCTAGAGGCAGAAGCAATAGAGCCATTCAACGATGGC GCAGACATCTGCCAGCAGCTCATGGACCGTTACGCCAAGTCCTCTGCTCCGCAGCACCGC CACCTCCTCGCCACTGCCGCCGCAATGCGCTCAATCCTTGCCGCCGAGTCGCTTCCCCTC ACTCCACCGGCCTATTTCGCCGCCACCATCTCCGCCATCGACGACATGTCGTCTTCCGTG TCCCAGAACCTGGACCCCACCGGCGTAGCGGCGCTGTTGTCTTTTCTGGCCATGGTGCTC CCGCTGATGCCTCCACGGAGTGTCTCGTCAGGGAAGGCGGGTGAGGCCGTATCGATGTTG ATTGAGCTTCTGGAAAAAGAGGAGGGGCTGGCCATGTCCAGCGTGAGGGCTTTGATAAAA TGTTTGGGGGTTTTGGTGGGGTTTTGTGATTTGGAGGATTGGGGATCCATCAAATTGGGT TTGGAGACATTGCTCAAGTTCTCCGTCGATAGGCGACCCAAGGTCCGTAAATGTTCCCAA GATTGTCTTGAGAGTGTTTTTAAGTCGCTCCAGTCTCGTGCTGTTATCAAGGAGGTGAGC AAGCTGGTACTGTCTAAGCTCAAAGGTTACATGCCTTTAGCAGTTGAATTATGTTCACGG ACTAAAAATGGACCTAAAAATTTAGAGGTCCTTCACATGCTAAATGTGGTGAAGCTTACT GTTCCCTTTCTCTCAGCAAAAGTCAGTTCAAAACTTCTTTCAGAAATGAATAAGCTTGTT GGTTCACGGTTCTCAGCACTCACAAGGCACGTTCTCCAAATTATTGAAGCATTATTTAAG ACCTCTAGAGTTAATGCGATTGTTTCAGAGACAGAGGAGGCTATATCTTCTCTTGCTTCA TTTGTGTCTAAGGGAGATAAGAACCCCTTGGACACTGTAATGTCTGCAGCAACCTTACTA AAATCTTCTGTGTGTATACTTCATACTGGTGAATCAACATCGTGGATTAATAATCTTCCT CTAGTTTGTGGTTCTGTGGCGGGTCTTTTGACTTCTGAGGCTAGCACTGCAGCACATGCT TCAGGTATTTTGCAAGAGCTGATAAGCCAATTTGTGGATCAAAGAAGTTTGCTGGTGGGT GAAAGCCAATGTTCTGAAGATGGAGGACATGAGACTACGAAAGCAAGGGCGTTAATATCA ATATGCACTATTTTTGAGGATGCCCTTAGCACTTGTAAAGGATTGCCAAATGAGCATCTT TTGGACGTTATATCTGCTTTGTTCCTCAAGCTCGGAGGAATCTCCTATATCTATATGAAA AATATTCTTCTCAACCTTGCCAACTTAATGACCCTTGCTAGTGGGGACAAATCTAACACT GATCATCCTCAGAAATGTATTGGAACTGCAGTAATAGCTATGGGACCAGAGAGGATTCTT GAACTTTTGCCCATCTCTCTTAATGCTAGCGACTTCACCTGTTTAAACATTTGGTTGATA CCTATTTTGAAGAATTATGTTGTTGGAGCATCATTGGGTTACTATTTGGAGCATATCATG CCTCTTGCGAAATCCTTTTGTCGGGCCAGTACTAAAGTTAAAAAGTCAATAACCAGTCAA GATCTACAGGCTCATGCACGTGATCTGTTGGGATTGCTACCTGCTTTCTGTAATCTTCCA ACTGATATATGCCAAAAGTTTGGATCTTTGGCTGAGGTTTTAGTGACATTTCTGAAGGAC TCCTTAATGCATGAAAATATTTCAGTTGCCTTGCAGGTTCTTGTGAATCAGAACAAAAGA GTACTTGACCAAAAAGATGGTGGTGGTGAGACAAATTCCTATGATGTGAACAAAATGTTG CCAAAGTTCGAACACATACCCACTTATTCAAAGAAAACTGCTACCAGAAATATTAGGGCT TTGACATCATGTTCTGCTGAGTTGCTTCAGGCCCTAACAGACTTATTTCTTGATTCACTG CCTGGGAAGCGTTCATATCTAAAGGATGCCATAGGATGCTTGGCTTCAGTAACTGATTCG TCCATTTCCAAGAAGATTTTTGAATCATTGCTCGAGAAGTTCCAGTTCAAAGATGGCAGG GATGAATTTGGAAAGGTGGAGAGTCATACGGATGCATCATCTGGTGAAGAACAACGCAAC CTGAGTACTAGAGAGAAAGATGCTCAGAGATGCGTGATAATGGAATTAGCATCTTCTCTT GTTAAAGGAGCCAAGGAGGATCTCATCAATCTAATCTATATGTTTGCTAAAGATACTTTA CAGAATGATGACGAGGTAGCGAATCGTGAAGCATACCATGCTTTGAGCAGAATTCTAGAG GAACATACTTGGTTCTGTTCTTCCCAATTTGCTGAGTTGATTGATCTGTTACTTGGTTTG AGATCTCCTGTTGATATCTATTCTCTAAAGAGTCGTTTCGCATGTTTCCAGACTTTAATG ATTCATACTTTGAAGGTAGACTCAGAGTTGGAAAATTCAAAGTCGTTTCTTATTCTCAAT GAGATCATAGTCACGTTAAAGGATGCCAAGGATGAAGCAGTTAGGGAAGCAGCTTATGAT ATACTCCACAAAATAAGTGTTAGCTTGAGAGACACATCATGTGTCAGTTCAGATGGACCT TACCAGAAGCTAATTAACATGATAATGGGCTATCTTTCCGGTGGATCACCTCACATAAAG AGTGGAGCAGTGTCTGTGCTATCAGTGCTGATGTATAAGGATACAGATATTTGTCTTTCG ATGCCTGATCTTGTTCCCTCTCTTTTATCTTTGCTGCAAGGGAAAGCTCTAGAAGTTATA AAAGCTGTTTTGGGCTTTGTGAAAGTACTAGTATCTTGCTTACAAGCTAGACGTCTGCAA AATCTTCTTCCTGATATCGTCAATGCAGTTCTCCCATGGTCACCTGTCTCGAGACATCAT TTCAAATCAAAGGCACGTACATATTTAGCAATAATGCTTTTAGTGGCTATACAAATGCAC ACGCATGTCACAATCATAATGGAGATTCTGTTAAGGAAGTGTGGTACTGCAGCAGTTCAG TTAGTTACGCCAGATAAATACAAGAATTTTGTCAAGGGTATTTTGGAGAGCCGCCATAAC AAGAAAAGTTCCAACGAAGTTGCCACAACCGATATAGATACAAGTCATGAAGATTCTTCA ACCAACAGGATGGAGGATAGAAAACGCAAGGGTTTTGGTACGCGACCTGAAAAGAATGAA TCAACGGAACATAGAATGAGTAAAAGGGCAAAGAAACACATGCCCAGCAACCCTAGAACC AATGAGCTTCATATGTCTTCTGGGGGTGGACTGAAGCGAGCTGGGAGAGGTAGGCAATCT GATGGTGTAAAATCAATTAAGGACCAGCCAGAAAGAAGTGGAAAGACAAACAAAGAGAAT TATAATAAAGGGCCCAAAAGTGGTCGCAAGAGGAAGATAGATGAGACAAATATGAGCAAG GGTGCAGCTGGGAGGCAGAGGCCTAGCACTAATAGTAATAAATCCACCAAATTATTCAAG CACAAAAAGGTTGGGAGAAAACAGTAG
PEP MDEEHHHDLEAEAIEPFNDGADICQQLMDRYAKSSAPQHRHLLATAAAMRSILAAESLPL TPPAYFAATISAIDDMSSSVSQNLDPTGVAALLSFLAMVLPLMPPRSVSSGKAGEAVSML IELLEKEEGLAMSSVRALIKCLGVLVGFCDLEDWGSIKLGLETLLKFSVDRRPKVRKCSQ DCLESVFKSLQSRAVIKEVSKLVLSKLKGYMPLAVELCSRTKNGPKNLEVLHMLNVVKLT VPFLSAKVSSKLLSEMNKLVGSRFSALTRHVLQIIEALFKTSRVNAIVSETEEAISSLAS FVSKGDKNPLDTVMSAATLLKSSVCILHTGESTSWINNLPLVCGSVAGLLTSEASTAAHA SGILQELISQFVDQRSLLVGESQCSEDGGHETTKARALISICTIFEDALSTCKGLPNEHL LDVISALFLKLGGISYIYMKNILLNLANLMTLASGDKSNTDHPQKCIGTAVIAMGPERIL ELLPISLNASDFTCLNIWLIPILKNYVVGASLGYYLEHIMPLAKSFCRASTKVKKSITSQ DLQAHARDLLGLLPAFCNLPTDICQKFGSLAEVLVTFLKDSLMHENISVALQVLVNQNKR VLDQKDGGGETNSYDVNKMLPKFEHIPTYSKKTATRNIRALTSCSAELLQALTDLFLDSL PGKRSYLKDAIGCLASVTDSSISKKIFESLLEKFQFKDGRDEFGKVESHTDASSGEEQRN LSTREKDAQRCVIMELASSLVKGAKEDLINLIYMFAKDTLQNDDEVANREAYHALSRILE EHTWFCSSQFAELIDLLLGLRSPVDIYSLKSRFACFQTLMIHTLKVDSELENSKSFLILN EIIVTLKDAKDEAVREAAYDILHKISVSLRDTSCVSSDGPYQKLINMIMGYLSGGSPHIK SGAVSVLSVLMYKDTDICLSMPDLVPSLLSLLQGKALEVIKAVLGFVKVLVSCLQARRLQ NLLPDIVNAVLPWSPVSRHHFKSKARTYLAIMLLVAIQMHTHVTIIMEILLRKCGTAAVQ LVTPDKYKNFVKGILESRHNKKSSNEVATTDIDTSHEDSSTNRMEDRKRKGFGTRPEKNE STEHRMSKRAKKHMPSNPRTNELHMSSGGGLKRAGRGRQSDGVKSIKDQPERSGKTNKEN YNKGPKSGRKRKIDETNMSKGAAGRQRPSTNSNKSTKLFKHKKVGRKQ


| Top |